KEGG   Escherichia coli B REL606: ECB_01799Help
Entry
ECB_01799         CDS       T00944                                 

Gene name
yebQ
Definition
(GenBank) predicted transporter
  KO
K08169  
MFS transporter, DHA2 family, multidrug resistance protein
Organism
ebr  Escherichia coli B REL606
Brite
Transporters [BR:ebr02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    ECB_01799 (yebQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1888853..1890226
Genome map
AA seq 457 aa AA seqDB search
MPKVQADGLPLPQRYGAILTIVIGISMAVLDGAIANIALPTIATDLHATPASSIWVVNAY
QIAIVISLLSFSFLGDMFGYRRIYKCGLVVFLLSSLFCALSDSLQMLTLARVIQGFGGAA
LMSVNTALIRLIYPQRFLGRGMGINSFIVAVSSAAGPTIAAAILSIASWKWLFLINVPLG
IIALLLAMRFLPPNGSRASKPRFDLPSAVMNALTFGLLITALSGFAQGQSLTLIAAELVV
MVVVGIFFIRRQLSLPVPLLPVDLLRIPLFSLSICTSVCSFCAQMLAMVSLPFYLQTVLG
RSEVETGLLLTPWPLATMVMAPLAGYLIERVHAGLLGALGLFIMAAGLFSLVLLPASPAD
INIIWPMILCGAGFGLFQSPNNHTIITSAPRERSGGASGMLGTARLLGQSSGAALVALML
NQFGDNGTHVSLMAAAILAVIAACVSGLRITQPRSRA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagttcaggccgacggcctgccattgccccagcgatacggtgcgatattaacc
attgtgattggtatttcgatggctgtccttgacggcgcaatcgccaacatcgccctgcca
acaatcgccacggaccttcatgccacgccagccagttccatctgggtagtgaacgcctat
caaatcgccattgtcatctccctgctctcgttttcgtttctgggcgatatgtttggctat
cgacgtatttataaatgcggtctggtcgtttttctgttgtcttcactgttctgcgccctt
tctgattcgctgcaaatgctcacccttgcgcgtgtcatacaaggtttcggcggtgcagcg
ttgatgagcgttaataccgcacttatccgcctgatctatccacaacgttttctggggaga
gggatgggcataaactcgtttattgttgccgtctcttctgctgccgggccgacaattgct
gcagcaatcctctccatcgcatcctggaaatggttatttttaatcaacgtaccgttaggt
attatcgccctgcttctggcgatgcgttttctgccacccaatggttctcgcgccagtaaa
ccccgtttcgacctgcccagcgccgtgatgaacgcgttaaccttcggcctgcttatcact
gcgttgagtggtttcgctcaggggcaatcgctgacgttaattgctgcggaactggtggta
atggttgttgttggtattttctttattcgccgccagctttctcttcccgtaccgctgcta
ccggtggatttactgcgtatcccgctgttttcactttctatttgcacatctgtttgctct
ttctgcgcacaaatgctggcaatggtttccctgcccttttacctgcaaaccgtgctcggg
cgtagtgaagtcgaaacaggtttacttctgacaccgtggccgttagcaacgatggtgatg
gctccgttggcaggctatttgattgaacgcgtacatgcaggattgctgggtgctctaggg
ttgttcatcatggctgcggggcttttttccctggttctgctgcccgcgtcacctgcggat
atcaatattatctggccgatgatcttatgtggcgctggatttggcttgttccagtcaccc
aataaccacaccattattacctccgctcctcgcgaacgtagcggtggagccagtggcatg
ttaggaacggctcgtctactgggtcagagtagcggcgcggcactggtggcgctgatgcta
aatcagttcggtgataatggtacgcacgtttcgctgatggctgcggctattctggcagtg
attgctgcctgtgtcagtggtttacgtatcactcagccacgatccagggcataa

DBGET integrated database retrieval system