KEGG   Escherichia coli B REL606: ECB_01807Help
Entry
ECB_01807         CDS       T00944                                 

Gene name
yebV
Definition
(GenBank) hypothetical protein
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1900357..1900593
Genome map
AA seq 78 aa AA seqDB search
MKTSVRIGAFEIDDGELHGESPGDRTLTIPCKSDPDLCMQLDAWDAETSIPALLNGEHSV
LYRTRYDQQSDAWIMRLA
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccagtgtgcgcataggcgcttttgaaatcgacgacggcgaattacacggtgaa
tcgccgggtgatcgaacattaaccattccttgtaaatctgaccccgatttatgtatgcaa
ctggatgcctgggatgctgaaaccagtatccctgccctgctaaatggcgaacactctgtc
ctttaccgtacccgttacgatcaacaatctgatgcctggattatgcgtcttgcctga

DBGET integrated database retrieval system