KEGG   Escherichia coli B REL606: ECB_01808Help
Entry
ECB_01808         CDS       T00944                                 

Gene name
yebW
Definition
(GenBank) hypothetical protein
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1482
Motif
Other DBs
NCBI-ProteinID: ACT39469
Position
1900698..1900889
Genome map
AA seq 63 aa AA seqDB search
MFALVLFVCYLDGGCEDIVVDVYNTEQQCLYSMSDQRIRHGGCFPIEDFIDGFWRPAQEY
GDF
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgctggtactttttgtttgctacctggatggcggttgtgaagatatcgttgtg
gatgtctacaacacggaacagcagtgtctttattctatgagcgatcaacggatccgccat
ggcggttgttttccgattgaggattttatagatggtttctggcgacctgcacaggagtat
ggtgatttttaa

DBGET integrated database retrieval system