KEGG   Escherichia coli B REL606: ECB_01809Help
Entry
ECB_01809         CDS       T00944                                 

Gene name
pphA
Definition
(GenBank) serine/threonine-specific protein phosphatase 1
  KO
K07313  
serine/threonine protein phosphatase 1 [EC:3.1.3.16]
Organism
ebr  Escherichia coli B REL606
Brite
Enzymes [BR:ebr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     ECB_01809 (pphA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1900890..1901546)
Genome map
AA seq 218 aa AA seqDB search
MKQPAPVYQRIAGHQWRHIWLSGDIHGCLEQLRRKLWHCRFDPWRDLLISVGDVIDRGPQ
SLRCLQLLEQHWVCAVRGNHEQMAMDALASQQMSLWLMNGGDWFIALADNQQKQAKTALE
KCQHLPFILEVHSRTGKHVIAHADYPDDVYEWQKDVDLHQVLWSRSRLGERQKGQGITGA
DHFWFGHTPLRHRVDIGNLHYIDTGAVFGGELTLVQLQ
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcctgcgcccgtttatcagagaattgcgggtcatcaatggcgacatatctgg
ctttctggcgatatacacggttgtcttgagcagttgcgccgcaaattatggcattgtcgt
tttgatccgtggcgagatttacttatctcagtgggagacgttatcgatcgtgggccgcaa
agtttacgttgtctgcagttactggaacaacattgggtttgtgcggtaagaggcaatcat
gaacagatggcgatggatgcgctggcatcccagcagatgtctttgtggttgatgaatggc
ggcgactggtttattgcgctggcagataatcaacagaaacaagcgaaaacggcgctggaa
aaatgtcagcatttgccctttattcttgaagtacatagtcgcaccggcaaacatgttatt
gctcatgccgattatccagatgatgtttatgaatggcaaaaggacgttgatttgcatcag
gtcttgtggagccgctcgcgattaggtgaacgccaaaaagggcagggaattacaggtgct
gatcatttctggtttggtcatacaccgttgcgccatcgcgtggatattggcaacctgcat
tatattgatacaggtgctgtctttgggggcgaactgactcttgtgcaattgcaataa

DBGET integrated database retrieval system