KEGG   Escherichia coli B REL606: ECB_01811Help
Entry
ECB_01811         CDS       T00944                                 

Gene name
yebZ
Definition
(GenBank) predicted inner membrane protein
  KO
K07245  copper resistance protein D
Organism
ebr  Escherichia coli B REL606
Brite
Transporters [BR:ebr02000]
 Other Transporters
  Others
   ECB_01811 (yebZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CopD
Motif
Other DBs
NCBI-ProteinID: ACT39472
Position
complement(1902295..1903167)
Genome map
AA seq 290 aa AA seqDB search
MLAFTWIALRFIHFTSLMLVFGFAMYGAWLAPLTIRRLLAKRFLRLQQHAAVWSLISATA
MLAVQGGLMGTGWTDVFSPNIWQAVLQTQFGGVWLWQIVLALVTLIVALMQPRNMPRLLF
MLTTAQFFLLAGVGHATLNEGVTEKIHQTNHAIHLICAAAWFGGLLPVLWCMQLIKGRWR
HQTIQALMRFSWCGHFAVIGVLASGVLNALLITGFPPTLTTYWGQLLLLKAILVMIIVVI
ALANRYVLVPRMRQDEDRAAPLFVWMTKLEWAIGAVVLVIISLLATLEPF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgtttacctggatcgcgctgcgatttatccatttcacctcgctgatgctggtt
tttggcttcgcaatgtacggtgcctggctggcccccttaacgattcgtcgtttgctggcg
aagcgttttctgcgtttacaacagcacgctgccgtctggagtttgatcagtgccactgca
atgctcgccgttcagggcgggttgatgggaacgggatggacagatgtattttcgccaaac
atttggcaggctgttttacaaacgcagtttggtggcgtctggttatggcaaattgttctc
gccctcgtaacgttgatcgtcgcccttatgcaaccgcggaatatgccacgtttgctgttt
atgctcactaccgcgcaattttttctgctggcgggagtggggcatgcgacgctgaatgaa
ggggtaacggagaaaatccatcagactaatcacgcgattcacctgatttgtgcggcggcg
tggtttgggggattactgccggtgctctggtgtatgcaactcatcaaaggccgttggcga
caccagactattcaggcgctgatgcgtttttcctggtgcgggcattttgcggtgatcggc
gtactggcaagcggcgtgcttaatgcattgttgattaccggatttccccccacgcttacg
acttactggggccaactcttattgctcaaagccatcctggtgatgattatagtggtcatt
gcgctggctaatcgttatgttcttgtaccgcgcatgaggcaggatgaagatcgtgcggca
cccttgtttgtgtggatgactaaactcgaatgggcgataggtgcggtagtactggtgatc
atcagcctgcttgcgactctcgaacctttttga

DBGET integrated database retrieval system