KEGG   Escherichia coli B REL606: ECB_01816Help
Entry
ECB_01816         CDS       T00944                                 

Gene name
ptrB
Definition
(GenBank) protease II
  KO
K01354  
oligopeptidase B [EC:3.4.21.83]
Organism
ebr  Escherichia coli B REL606
Brite
Enzymes [BR:ebr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.83  oligopeptidase B
     ECB_01816 (ptrB)
Peptidases [BR:ebr01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   ECB_01816 (ptrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1905355..1907415)
Genome map
AA seq 686 aa AA seqDB search
MLPKAARIPHAMTLHGDTRIDNYYWLRDDTRSQPEVLDYLQQENSYGHRVMASQQALQDR
ILKEIIDRIPQREVSAPYIKNGYRYRHIYEPGCEYAIYQRQSAFSEEWDEWETLLDANER
AAHSEFYSMGGMAITPNNTIMALAEDFLSRRQYGIRFRNLETGNWYPELLDNVEPSFVWA
NDSWTFYYVRKHPVTLLPYQVWRHAIGTPASQDKLIYEEKDDTYYVSLHKTTSKHYVVIH
LASATTSEVRLLDAEMADAEPFVFLPRRKDHEYSLDHYQHRFYLRSNRHGKNFGLYRTRM
RDEQQWEELIPPRENIMLEGFTLFTDWLVVEERQRGLTSLRQINRKTREVIGIAFDDPAY
VTWIAYNPEPETARLRYGYSSMTTPDTLFELDMDTGERRVLKQTEVPGFDAANYRSEHLW
IVARDGVEVPVSLVYHRKHFRKGHNPLLVYGYGSYGASIDADFSFSRLSLLDRGFVYAIV
HVRGGGELGQQWYEDGKFLKKKNTFNDYLDACDALLKLGYGSPSLCYAMGGSAGGMLMGV
AINQRPELFHGVIAQVPFVDVVTTMLDESIPLTTGEFEEWGNPQDPQYYEYMKSYSPYDN
VTAQAYPHLLVTTGLHDSQVQYWEPAKWVAKLRELKTDDHLLLLCTDMDSGHGGKSGRFK
SYEGVAMEYAFLVALAQGTLPATPAD
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgctaccaaaagccgcccgcattccccacgccatgacgcttcatggcgatacgcgcatc
gataattactactggctgcgggacgatacgcgttctcagccagaagtcctggactacctg
caacaagaaaatagttacggtcatcgggtgatggcctcacaacaagccttgcaggatcgc
atcttaaaggaaatcatcgaccgcattccgcaacgagaagtttctgcgccctacatcaaa
aatggctaccgctatcggcatatttatgaaccaggctgtgaatatgctatctaccagcgt
caatcggcattcagtgaagagtgggatgagtgggaaacattgctcgatgccaatgagcgc
gcagctcatagtgagttttattcgatgggcggaatggcgattacgcccaataacaccatc
atggcgctggcagaagattttctttcccgacgccagtacggcattcgttttcgtaatctg
gaaacaggtaactggtacccggaactgctggataacgttgaacccagctttgtctgggca
aatgactcctggactttctactatgttcgcaagcatccggtgacgctgctgccttatcag
gtctggcgtcacgccatcggtacgccagcatcgcaagataaactgatttacgaagaaaaa
gacgatacctattacgtcagcctgcataaaacgacctcgaagcactatgtagttattcat
ttggccagcgccaccaccagtgaagttcgcctgctggacgcggaaatggccgatgccgag
ccgtttgtttttctgccgcgccgcaaagatcacgaatacagccttgatcactaccagcat
cgtttttatctgcgttccaaccgccacggcaaaaactttggcttataccgtacccgtatg
cgtgatgagcaacagtgggaagagttaattccgccacgcgaaaacatcatgctggaaggg
tttacgctgtttaccgactggctggtggttgaagagcgtcagcgcgggttaaccagtttg
cgccaaattaaccgcaagacccgggaagtcattggtattgcctttgatgatccagcctat
gtgacctggattgcctacaatccagaacctgaaaccgcgcgattgcgttatggttattct
tccatgaccacaccagacactttgtttgaactggatatggataccggtgagcgtcgtgta
ttaaaacaaacagaagtgcccggttttgatgcggcgaattaccgcagtgaacacctgtgg
atagtcgcccgtgatggcgtcgaagttccggtttcgttggtctaccatcgcaaacatttt
cgcaaaggacacaacccgttgctggtgtatggctatggttcttacggcgcaagtattgat
gccgatttcagttttagccgcttgagtttattagatcgtggctttgtctacgccattgtc
catgttcgcggcggtggtgagctggggcaacaatggtacgaagacggaaaatttctgaag
aagaaaaatacgtttaatgattatcttgatgcctgcgatgcattgttaaaactgggctat
ggctctccttcgctttgttatgcgatgggcgggagtgcggggggcatgttgatgggcgtt
gcaattaatcaacgcccggaattattccacggcgttatcgcccaggtaccgtttgttgat
gttgtaacaacgatgcttgatgaatcaattcctcttaccactggtgagtttgaagagtgg
ggtaacccgcaggatccgcaatattacgagtacatgaaaagctacagcccgtatgacaac
gtcaccgcacaggcttatccgcatttactggtaacgaccggtttgcacgattctcaggtg
caatattgggaaccggcaaaatgggtcgctaaattgcgcgagctgaaaaccgatgaccat
cttttattgctctgtaccgacatggactcaggccatggcggtaaatctggtcgctttaaa
tcgtacgaaggcgtagcgatggaatatgcttttctggtcgcgctggcgcagggaacatta
cccgctacgcctgcggattaa

DBGET integrated database retrieval system