KEGG   Escherichia coli B REL606: ECB_01819Help
Entry
ECB_01819         CDS       T00944                                 

Gene name
yebG
Definition
(GenBank) conserved hypothetical protein regulated by LexA
  KO
K09918  
uncharacterized protein
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1909033..1909323)
Genome map
AA seq 96 aa AA seqDB search
MAVEVKYVVIREGEEKMSFTSKKEADAYDKMLDTADLLDTWLTNSPVQMEDEQREALSLW
LAEQKDVLSTILKTGKLPSPQVVGAESEEEDASHAA
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgaagttaaatacgtagtcattcgtgagggcgaagagaaaatgtcgtttacc
agcaaaaaggaagccgatgcttatgataaaatgcttgatacggcggatctgcttgacacc
tggctgacaaattctccagtgcaaatggaagacgagcaacgtgaagccctttcgctatgg
ctggcagaacaaaaagatgtgctgagcaccattctgaaaaccggcaaattaccgtcccca
caggtcgtcggtgctgaatccgaagaggaagatgcctcacacgcggcctga

DBGET integrated database retrieval system