KEGG   Escherichia coli B REL606: ECB_01826Help
Entry
ECB_01826         CDS       T00944                                 

Gene name
msbB
Definition
(GenBank) lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase
  KO
K02560  lauroyl-Kdo2-lipid IVA myristoyltransferase [EC:2.3.1.243]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00540  Lipopolysaccharide biosynthesis
ebr01100  Metabolic pathways
Module
ebr_M00060  Lipopolysaccharide biosynthesis, KDO2-lipid A
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ECB_01826 (msbB)
Enzymes [BR:ebr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.243  lauroyl-Kdo2-lipid IVA myristoyltransferase
     ECB_01826 (msbB)
Lipopolysaccharide biosynthesis proteins [BR:ebr01005]
 Lipid A
  ECB_01826 (msbB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lip_A_acyltrans
Motif
Other DBs
NCBI-ProteinID: ACT39487
Position
complement(1917798..1918769)
Genome map
AA seq 323 aa AA seqDB search
METKKNNSEYIPEFDKSFRHPRYWGAWLGVAAMAGIALTPPKFRDPILARLGRFAGRLGK
SSRRRALINLSLCFPERSEAEREAIVDEMFATAPQAMAMMAELAIRGPEKIQPRVDWQGL
EIIEEMRRNNEKVIFLVPHGWAVDIPAMLMASQGQKMAAMFHNQGNPVFDYVWNTVRRRF
GGRLHARNDGIKPFIQSVRQGYWGYYLPDQDHGPEHSEFVDFFATYKATLPAIGRLMKVC
RARVVPLFPIYDGKTHRLTIQVRPPMDDLLEADDHTIARRMNEEVEIFVGPRPEQYTWIL
KLLKTRKPGEIQPYKRKDLYPIK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgaaaaaaaataatagcgaatacattcctgagtttgataaatcctttcgccac
ccgcgctactggggagcatggctgggcgtagcagcgatggcgggtatcgctttaacgccg
ccaaagttccgtgatcccattctggcacggctgggacgttttgccggacgactgggaaaa
agctcacgccgtcgtgcgttaatcaatctgtcgctctgctttccagaacgtagtgaagct
gaacgcgaagcgattgttgatgagatgtttgccaccgcgccgcaagcgatggcaatgatg
gctgagttggcaatacgcgggccggagaaaattcagccgcgcgttgactggcaagggctg
gagatcatcgaagagatgcggcgtaataacgagaaagttatctttctggtgccgcacggt
tgggccgtcgatattcctgccatgctgatggcctcgcaagggcagaaaatggcagcgatg
ttccataatcagggcaacccggtttttgattatgtctggaacacggtgcgtcgtcgcttt
ggcggtcgtctgcatgcgagaaatgacggtattaaaccattcatccagtcggtacgtcag
gggtactggggatattatttacccgatcaggatcatggcccagagcacagcgaatttgtg
gatttctttgccacctataaagcgacgttgcccgcgattggtcgtttgatgaaagtgtgc
cgtgcgcgcgttgtaccgctgtttccgatttatgatggcaagacgcatcgtctgacgatt
caggtgcgcccaccgatggatgatctgttagaggcggatgatcatacgattgcgcggcgg
atgaatgaagaagtcgagatttttgttggtccgcgaccagaacaatacacctggatacta
aaattgctgaaaactcgcaaaccgggcgaaatccagccgtataagcgcaaagatctttat
cccatcaaataa

DBGET integrated database retrieval system