KEGG   Escherichia coli B REL606: ECB_01827Help
Entry
ECB_01827         CDS       T00944                                 

Gene name
yebA
Definition
(GenBank) predicted peptidase
  KO
K19304  murein DD-endopeptidase [EC:3.4.24.-]
Organism
ebr  Escherichia coli B REL606
Brite
Enzymes [BR:ebr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     ECB_01827 (yebA)
Peptidases [BR:ebr01002]
 Metallo Peptidases
  Family M23
   ECB_01827 (yebA)
Peptidoglycan biosynthesis and degradation proteins [BR:ebr01011]
 Peptidoglycan biosynthesis and degradation
  Endopeptidase
   ECB_01827 (yebA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M23 OapA LysM Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACT39488
Position
complement(1918889..1920148)
Genome map
AA seq 419 aa AA seqDB search
MLGSLTVLTLAVAVWRPYVYHRDATPIVKTIELEQNEIRSLLPEASEPIDQAAQEDEAIP
QDELDDKIAGEAGVHEYVVSTGDTLSSILNQYGIDMGDITQLAAADKELRNLKIGQQLSW
TLTADGELQRLTWEVSRRETRTYDRTAANGFKMTSEMQQGEWVNNLLKGTVGGSFVASAR
NAGLTSAEVSAVIKAMQWQMDFRKLKKGDEFAVLMSREMLDGKREQSQLLGVRLRSEGKD
YYAIRAEDGKFYDRNGTGLAKGFLRFPTAKQFRISSNFNPRRTNPVTGRVAPHRGVDFAM
PQGTPVLSVGDGEVVVAKRSGAAGYYVAIRHGRSYTTRYMHLRKILVKPGQKVKRGDRIA
LSGNTGRSTGPHLHYEVWINQQAVNPLTAKLPRTEGLTGSDRREFLAQAKEIVPQLRFD
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgttggggtcgctcaccgttcttactctggccgtcgctgtctggcggccttatgtttat
caccgtgatgccacgccaattgtcaaaaccattgagctggaacagaacgaaattcgttcg
ctcttacctgaagccagtgagccgattgatcaagctgcacaagaagatgaagccattccc
caggacgaactggatgacaaaatcgccggtgaagcgggcgtgcatgaatatgttgtttcc
actggcgatacgctaagcagcattctcaatcagtatggtattgatatgggtgatatcacc
caactggctgcggccgacaaagaattgcgtaacctgaaaatcggtcaacaactctcctgg
acattaaccgcggacggcgaactgcagcgcctcacctgggaagtgtctcgtcgtgaaacc
cgaacctatgaccgtactgccgctaacggttttaaaatgaccagcgaaatgcagcaagga
gagtgggttaacaatctgctgaaaggtaccgtcgggggaagctttgttgccagcgccaga
aacgccggtttaaccagcgccgaagtgagcgcagtgattaaagccatgcagtggcaaatg
gatttccgcaaactgaaaaaaggcgatgaatttgcggtgttaatgtctcgagaaatgctt
gatggtaaacgtgagcaaagccagctgctgggcgtacgtttgcgttcagaaggtaaagat
tattacgctatccgcgctgaagatggcaaattctacgatcgtaacggtactggtctggcg
aaaggattcttgcgattcccgacggcgaaacagttccgtatctcgtctaactttaacccg
cgtcgtactaatccggtgaccggtcgcgttgcaccacacagaggtgttgatttcgccatg
ccgcagggtacgccagtgctttcagtgggtgacggtgaagtggtggttgccaaacgcagt
ggcgcagcaggttattatgtggctattcgtcatggtcgcagctacaccacgcgttatatg
cacttgcgcaagattctggtgaaaccgggacagaaggtgaaacgtggcgaccgtatcgcg
ctttccggtaataccggacgttcaaccgggccgcatctgcactatgaagtatggataaac
cagcaggccgtaaacccgctgacggcaaaactgccgcgtaccgaagggctgaccggctcc
gatcgtcgcgaattcctggcgcaggccaaagagattgtgccgcagctacggtttgattaa

DBGET integrated database retrieval system