KEGG   Escherichia coli B REL606: ECB_01922Help
Entry
ECB_01922         CDS       T00944                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00340  Histidine metabolism
ebr01100  Metabolic pathways
ebr01110  Biosynthesis of secondary metabolites
ebr01230  Biosynthesis of amino acids
Module
ebr_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    ECB_01922 (hisD)
Enzymes [BR:ebr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ECB_01922 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACT39580
Structure
PDB: 

Jmol
Position
2021162..2022403
Genome map
AA seq 413 aa AA seqDB search
MRPAISASESITRTVNDILDNVKTRGDEALREYSAKFDKTTVTALKVSAEEIAAASERLS
DELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRCQQVTRPVASVGLYIPGGSAPLFST
VLMLATPARIAGCKKVVLCSPPPIADEILYAAQLCGVQDVFNVGGAQAIAALAFGTESVP
KVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVLVIADSGATPDFVASDLLSQAE
HGPDSQVILLTPDADMARRVAEAVERQLAELPRAETARQALNASRLIVTKDLAQCVEISN
QYGPEHLIIQTRNARELVDGITSAGSVFLGDWSPESAGDYASGTNHVLPTYGYTATCSSL
GLADFQKRMTVQELSKVGFSALASTIETLAAAERLTAHKNAVTLRVNALKEQA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccggcgatctccgcttctgaaagcattacccgcactgttaacgatattctcgat
aacgtgaaaacgcgtggcgatgaggcccttcgggaatacagcgcgaagtttgataaaacc
acggttaccgcgctgaaggtgtctgctgaggagatcgccgccgccagcgaacgcctgagc
gacgagctaaaacaggcgatggcggtggcagtaaagaatattgaaaccttccacactgcg
caaaaactgccgccggtagatgtagaaacgcagccaggcgtacgttgccagcaagtcacg
cgtccggtagcttcagttgggttgtatattcctggcggctccgccccgctcttctcaacg
gtattaatgctggcaactccggcgcgtattgcgggctgtaaaaaagtggtgttgtgctca
ccgccgccgattgccgatgagatcctttatgcggcgcagctgtgcggtgtgcaggacgtg
tttaacgtcggcggcgcacaggccattgccgcgctggcgtttggtacggaatctgtgccg
aaagtggacaaaatcttcgggccgggtaacgcctttgtcaccgaagcaaaacgccaggta
agccagcgtctggacggtgcggcgatcgatatgcccgcaggcccgtcggaagtgctggtg
attgctgacagcggcgctacgccggatttcgtggcttctgatttgctttctcaggctgaa
cacggcccggactcacaggtgattttactgacgcccgacgccgatatggcgcgtcgcgtt
gccgaggctgtcgaacgccaactggcagaactgccgcgagctgaaaccgcccgccaggca
ctgaacgccagccgcctgatcgtgactaaagatttagcgcagtgcgtagagatctccaac
cagtacggcccggagcacctgatcattcagacccgcaacgcccgcgaactggtcgatggc
atcaccagcgccggttcggtatttcttggtgactggtcaccggaatcggcaggcgactat
gcctccggcaccaaccacgttctgccgacttacggttacaccgccacctgttccagcctc
gggctggcggatttccagaagcgcatgaccgtgcaggaactgtcgaaagtaggtttctcc
gctctggcgtcgaccattgaaacactggccgccgccgagcgcctgaccgcccacaaaaat
gccgttactttgcgtgttaacgcccttaaggagcaagcatga

DBGET integrated database retrieval system