KEGG   Escherichia coli B REL606: ECB_02945Help
Entry
ECB_02945         CDS       T00944                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha (EC:3.2.1.23)
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
ebr  Escherichia coli B REL606
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ECB_02945 (ebgA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ECB_02945 (ebgA)
Enzymes [BR:ebr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ECB_02945 (ebgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3155450..3158542
Genome map
AA seq 1030 aa AA seqDB search
MNRWENIQLTHENRLAPRAYFFSYDSVAQARTFARETSSLFLSLSGQWNFHFFDHPLQVP
EAFTSELMADWGHITVPAMWQMEGHGKLQYTDEGFPFPIDVPFVPSDNPTGAYQRIFTLS
DGWQGKQTLIKFDGVETYFEVYVNGQYVGFSKGSRLTAEFDISAMVKTGDNLLCVRVMQW
ADSTYVEDQDMWWSAGIFRDVYLVGKHLTHINDFTVRTDFDEAYCDATLSCEVVLENLAA
SPVVTTLEYTLFDGERVVHSSAIDHLAIEKLTSASFAFTVEQPQQWSAESPYLYHLVMTL
KDANGNVLEVVPQRVGFRDIKVRDGLFWINNRYVMLHGVNRHDNDHRKGRAVGMDRVEKD
LQLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVESHGFANVGDISRITDDPQW
EKVYVERIVRHIHAQKNHPSIIIWSLGNESGYGCNIRAMYHAAKALDDTRLVHYEEDRDA
EVVDIISTMYTRVPLMNEFGEYPHPKPRIICEYAHAMGNGPGGLTEYQNVFYKHDCIQGH
YVWEWCDHGIQAQDDHGNVWYKFGGDYGDYPNNYNFCLDGLIYSDQTPGPGLKEYKQVIA
PVKIHARDLTRGELKVENKLWFTTLDDYTLHAEVRAEGETLATQQIKLRDVAPNSEAPLQ
ITLPQLDAREAFLNITVTKDSRTRYSEAGHSIATYQFPLKENTAQPVPFAPNNARPLTLE
DDRLSCTVRGYNFAITFSKMSGKPTSWQVNGESLLTREPKINFFKPMIDNHKQEYEGLWQ
PNHLQIMQEHLRDFAVEQSDGEVLIISRTVIAPPVFDFGMRCTYIWRIAADGQVNVALSG
ERYGDYPHIIPCIGFTMGINGEYDQVAYYGRGPGENYADSQQANIIDIWRSTVDAMFENY
PFPQNNGNRQHVRWTALTNRHGNGLLVVPQRPINFSAWHYTQENIHAAQHCNELQRSDDI
TLNLDHQLLGLGSNSWGSEVLDSWRVWFRDFSYGFTLLPVSGGEATAQSLASYEFGAGFF
STNLHSENKQ
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctgggaaaacattcagctcacccacgaaaaccgacttgcgccgcgtgcgtac
tttttttcatatgattctgttgcgcaagcgcgtacctttgcccgcgaaaccagcagcctg
tttctgtccttaagcggtcagtggaatttccatttttttgaccacccgctgcaagtgcct
gaagccttcacctctgagttaatggctgactgggggcatattaccgtccccgccatgtgg
caaatggaaggtcacggcaaactgcaatataccgacgaaggttttccgttccccatcgat
gtgccgtttgtccccagcgataacccaaccggtgcctatcaacgtattttcaccctcagc
gacggctggcagggtaaacagacgctgattaaatttgacggcgtcgaaacctattttgaa
gtctatgttaacggtcagtatgtgggtttcagcaagggcagtcgcctgaccgcagagttt
gacatcagcgcgatggttaaaaccggcgacaacctgttgtgtgtgcgcgtgatgcagtgg
gcggactctacctacgtggaagaccaggatatgtggtggtcagcggggatcttccgcgat
gtttatctggtcggaaaacacctaacgcatattaacgatttcactgtgcgtaccgacttt
gacgaagcctattgcgatgccacgctttcctgcgaagtggtgctggaaaatctcgccgcc
tcccctgtcgtcacgacgctggaatataccctgtttgatggcgaacgcgtggtgcacagc
agcgccattgatcatttggcaattgaaaaactgaccagcgccagctttgcttttactgtc
gaacagccgcagcaatggtcagcagaatccccttatctttaccatctggtcatgacgctg
aaagacgccaacggcaacgttctggaagtggtgccacaacgcgttggcttccgtgatatc
aaagtgcgcgacggtctgttctggatcaataaccgttatgtgatgctgcacggcgtcaac
cgtcacgacaacgatcatcgcaaaggccgcgccgttggaatggatcgcgtcgagaaagat
ctccagttgatgaagcagcacaatatcaactccgtgcgtaccgctcactacccgaacgat
ccgcgtttttacgaactgtgtgatatctacggcctgtttgtgatggcggaaaccgacgtc
gaatcgcacggctttgctaatgtcggcgatattagccgtattaccgacgatccgcagtgg
gaaaaagtctacgtcgagcgcattgttcgccatatccacgcgcagaaaaaccatccgtcg
atcatcatctggtcgctgggcaatgaatccggctatggctgtaacatccgcgcgatgtac
catgcggcgaaagcgctggatgacacgcgactggtgcattacgaagaagatcgcgatgct
gaagtggtcgatattatttccaccatgtacacccgcgtgccgctgatgaatgagtttggt
gaatacccgcatccgaagccgcgcatcatctgtgaatatgctcatgcgatggggaacgga
ccgggcgggctgacggagtaccagaacgtcttctataagcacgattgcattcagggtcat
tatgtctgggagtggtgcgaccacgggatccaggcacaggacgaccacggcaatgtctgg
tataaattcggcggcgactacggcgactatcccaacaactataacttctgtcttgatggt
ttgatctattccgatcagacgccgggaccgggcctgaaagagtacaaacaggttatcgcg
ccggtaaaaatccacgcgcgggatctgactcgcggcgagttgaaagtcgaaaataaactg
tggtttaccacgcttgatgactacaccctgcacgcagaggtgcgcgccgaaggtgaaacg
ctcgcgacgcagcagattaaactgcgcgacgttgcgccgaacagcgaagcccccttgcag
atcacgctgccgcagctggacgcccgcgaagcgttcctcaacattacggtgaccaaagat
tcccgcacccgctacagcgaagccgggcattctatcgccacttatcagttcccgctgaag
gaaaacaccgcgcagccagtgcctttcgcaccaaataatgcgcgtccgctgacgctggaa
gacgatcgtttgagctgcaccgttcgcggctacaacttcgcgatcaccttctcaaaaatg
agtggcaaaccgacatcctggcaggtgaatggcgaatcgctgctgactcgcgagccaaag
atcaacttcttcaagccgatgatcgacaaccacaagcaggagtacgaagggctgtggcaa
ccgaatcatttgcagatcatgcaggaacatctgcgcgactttgccgtagaacagagcgat
ggtgaagtgctgatcatcagccgcacagttattgccccgccggtgtttgacttcgggatg
cgctgcacctacatctggcgcatcgctgccgatggccaggttaacgtggcgctttccggc
gagcgttacggcgactatccgcacatcattccgtgcatcggtttcaccatgggaattaac
ggcgaatacgatcaggtggcgtattacggtcgtggaccgggcgaaaactacgccgacagc
cagcaggctaacatcatcgatatctggcgcagcaccgtcgatgccatgttcgagaactat
cccttcccgcagaacaacggtaaccgtcagcatgtccgctggacggcactgactaaccgc
cacggtaacggtctgctggtggttccgcagcgcccaattaacttcagcgcctggcactat
acccaggaaaacatccacgctgcccagcactgtaacgagctgcagcgcagtgatgacatc
accctgaacctcgatcaccagctgcttggcctcggctccaactcctggggcagcgaggtg
ctggactcctggcgcgtctggttccgtgacttcagctacggctttacgttgctgccggtt
tctggcggagaagctaccgcgcaaagcctggcgtcgtatgagttcggcgcagggttcttt
tccacgaatttgcacagcgagaataagcaatga

DBGET integrated database retrieval system