KEGG   Escherichia coli B REL606: ECB_03189Help
Entry
ECB_03189         CDS       T00944                                 

Gene name
chiA
Definition
periplasmic endochitinase (EC:3.2.1.14 3.2.1.17)
Orthology
K13381  
bifunctional chitinase/lysozyme [EC:3.2.1.14 3.2.1.17]
Organism
ebr  Escherichia coli B REL606
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ECB_03189 (chiA)
Enzymes [BR:ebr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     ECB_03189 (chiA)
    3.2.1.17  lysozyme
     ECB_03189 (chiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3395065..3397758)
Genome map
AA seq 897 aa AA seqDB search
MKLNIFTKSMIGMGLVCSALPALAMEAWNNQQGGNKYQVIFDGKIYENAWWVSSTNCPGK
AKANDATNPWRLKRTATAAEISQFGNTLSCEKSGSSSSSNSNTPASNTPANGGSATPAQG
TVPSNSSVVAWNKQQGGQTWYVVFNGAVYKNAWWVASSNCPGDAKGNDASNPWRYVRAAT
ATEISETSNPQSCTSAPQPAPDVKPAPDVKPAPDVQPAPADKSNDNYAVVAWKGQEGSST
WYVIYNGGIYKNAWWVGAANCPGDAKENDASNPWRYVRAATATEISQYGNPGSCSVKPDN
NGGTVTPVDPTPETPVTPTPDNSEPSTPADSGNDYSLQAWSGQEGSEIYHVIFNGNVYKN
AWWVGSKDCPRGTSAENSNNPWRLERTATAAELSQYGNPTTCEIDNGGVIVADGFQASKA
YSADSIVDYNDAHYKTSVDQDAWGFVPGGDNPWKKYEPAKAWSASTVYVKGDRVVVDGQA
YEALFWTQSDNPALVANQNATGSNSRPWKPLGKAQSYSNEELNNAPQFNPETLYASDTLI
RFNGVNYISQSKVQKVSPSDSNPWRVFVDWTGTKERVGTPKKAWPKHVYAPYVDFTLNTI
PDLAALAKNHNVNHFTLAFVVSKDANTCLPTWGTAYGMHNYAQYSKIKALREAGGDVMLS
IGGANNAPLAASCKNVDDLMQHYYDIVDNLNLKVLDFDIEGTWVADQASIERRNLAVKKV
QDKWKSEGKDIAIWYTLPILPTGLTPEGMNVLSDAKAKGVELAGVNVMTMDYGNAICQSA
NTEGQNIHGKCATSAIANLHSQLKGLHPNKSDAEIDAMMGTTPMVGVNDVQGEVFYLSDA
RLVMQDAQKRNLGMVGIWSIARDLPGGTNLSPEFHGLTKEQAPKYAFSEIFAPFTKQ
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaatatatttactaaatctatgattggtatggggctggtgtgttccgctctg
ccagcattggcaatggaagcatggaataaccaacaaggtggtaataaatatcaggttatt
ttcgatggcaaaatttatgaaaatgcctggtgggtttcttctacaaattgcccgggaaaa
gcgaaagcaaatgatgcaactaacccgtggcgtttaaagcgtaccgcaacagctgctgaa
attagtcagtttggcaatacactttcctgcgaaaagagcggcagctcatcttcttcaaat
tcaaatacgcctgcatccaatacgccggctaatggcggttcggctacaccagcacagggc
actgttccgtctaattcttctgtagttgcctggaataaacagcagggcggtcagacctgg
tatgtcgtctttaatggtgcggtatataaaaatgcctggtgggtagcctcttctaactgt
ccgggtgatgcgaaaggcaatgatgccagcaacccatggcgttatgttcgtgccgctacg
gcaacggaaatctcagaaaccagtaatccacagtcctgtacttcagcaccacagcctgca
ccggatgtgaaaccggcaccggacgttaaaccggctcctgatgttcagccagccccagct
gataagtcaaacgacaactatgctgtagtagcctggaaaggtcaggaaggttcttctaca
tggtacgttatctataacggcggcatttataagaacgcctggtgggtaggcgcggcaaat
tgcccaggcgatgcgaaagaaaacgatgccagtaacccatggcgttatgttcgcgcggca
acggcaacagaaatcagccagtatggtaaccctggctcctgttccgttaagccggataat
aatggcggtactgtgactccggttgatccaactccggaaacaccggtgaccccaactccg
gataacagcgagccatcaacaccagcggatagcggtaacgattactcattgcaagcgtgg
agcggccaggaaggtagcgaaatttaccatgttattttcaatggtaatgtttacaagaac
gcctggtgggttgggtctaaagattgcccacggggtaccagcgctgaaaactccaataac
ccatggcgtctcgagcgtacagctaccgctgcggaattgagtcagtacggtaacccgact
acctgtgaaattgataacggcggcgtcattgttgcggatggtttccaggccagcaaagcg
tacagcgcggacagcatcgtagattataacgatgcacattataaaacttctgtcgatcaa
gacgcatggggctttgtcccgggcggcgataacccgtggaagaaatacgaaccggcgaaa
gcatggtccgcatccactgtgtacgtgaaaggtgatcgcgttgttgttgatgggcaggct
tatgaagcgctgttctggacgcaaagtgacaaccctgctctggtggcgaaccaaaacgcc
accggtagcaatagccgcccgtggaagccgttaggtaaggctcagagctatagcaacgaa
gagctgaataatgcgccgcagtttaatccagaaacgctttatgccagcgatacgctgatt
cgctttaacggtgtgaactacatttctcagagtaaagtgcagaaagtttctccttctgac
agcaacccgtggcgtgtttttgttgactggaccggaaccaaagaacgtgtaggtacgccg
aagaaagcatggccgaaacacgtttatgcaccgtatgttgactttacgctgaatacgatc
ccggatttggctgcgctggctaagaatcataacgtcaaccacttcacgctggcatttgtg
gtgagtaaagatgcgaacacctgtctgccgacatggggtaccgcttatggtatgcacaat
tacgctcagtacagcaaaatcaaagctctgcgtgaggctggcggcgatgtgatgctgtct
atcggtggtgctaacaacgctccgctggctgcttcctgtaagaacgtagacgatctgatg
cagcattattatgacatcgttgataacctgaacctcaaagtcctggacttcgatatcgaa
ggcacctgggttgcggatcaggcatctattgaacgtcgtaaccttgctgtgaagaaagtg
caggataaatggaagtcagaaggcaaagatattgctatctggtacaccttgccaattctg
ccgactggcctgacgccggaagggatgaatgtcctgagcgatgccaaagcgaaaggtgtt
gagctggcgggtgtgaacgtgatgacaatggactacggtaacgcgatttgtcagtctgca
aataccgaaggccagaacattcacggtaagtgtgcaacgtctgcgattgccaacctgcat
tcacaattgaaaggcctccatcccaataagagcgatgcagaaattgacgctatgatgggt
accacgccgatggttggcgtgaacgacgttcagggcgaggtgttctatctctctgatgct
cgtctggtcatgcaggatgcgcagaagcgtaatctcggtatggttggtatctggtcaatc
gcgcgcgacctgccgggcggcactaacctgtctccggaattccacggcctgactaaagaa
caggcaccgaagtacgcatttagcgaaatcttcgcgccgtttactaagcaataa

DBGET integrated database retrieval system