KEGG   Escherichia coli B REL606: ECB_03189Help
Entry
ECB_03189         CDS       T00944                                 

Gene name
chiA
Definition
periplasmic endochitinase (EC:3.2.1.14 3.2.1.17)
Orthology
K13381  
bifunctional chitinase/lysozyme [EC:3.2.1.14 3.2.1.17]
Organism
ebr  Escherichia coli B REL606
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ebr00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3395065..3397758)
Genome map
AA seq 897 aa AA seqDB search
MKLNIFTKSMIGMGLVCSALPALAMEAWNNQQGGNKYQVIFDGKIYENAWWVSSTNCPGK
AKANDATNPWRLKRTATAAEISQFGNTLSCEKSGSSSSSNSNTPASNTPANGGSATPAQG
TVPSNSSVVAWNKQQGGQTWYVVFNGAVYKNAWWVASSNCPGDAKGNDASNPWRYVRAAT
ATEISETSNPQSCTSAPQPAPDVKPAPDVKPAPDVQPAPADKSNDNYAVVAWKGQEGSST
WYVIYNGGIYKNAWWVGAANCPGDAKENDASNPWRYVRAATATEISQYGNPGSCSVKPDN
NGGTVTPVDPTPETPVTPTPDNSEPSTPADSGNDYSLQAWSGQEGSEIYHVIFNGNVYKN
AWWVGSKDCPRGTSAENSNNPWRLERTATAAELSQYGNPTTCEIDNGGVIVADGFQASKA
YSADSIVDYNDAHYKTSVDQDAWGFVPGGDNPWKKYEPAKAWSASTVYVKGDRVVVDGQA
YEALFWTQSDNPALVANQNATGSNSRPWKPLGKAQSYSNEELNNAPQFNPETLYASDTLI
RFNGVNYISQSKVQKVSPSDSNPWRVFVDWTGTKERVGTPKKAWPKHVYAPYVDFTLNTI
PDLAALAKNHNVNHFTLAFVVSKDANTCLPTWGTAYGMHNYAQYSKIKALREAGGDVMLS
IGGANNAPLAASCKNVDDLMQHYYDIVDNLNLKVLDFDIEGTWVADQASIERRNLAVKKV
QDKWKSEGKDIAIWYTLPILPTGLTPEGMNVLSDAKAKGVELAGVNVMTMDYGNAICQSA
NTEGQNIHGKCATSAIANLHSQLKGLHPNKSDAEIDAMMGTTPMVGVNDVQGEVFYLSDA
RLVMQDAQKRNLGMVGIWSIARDLPGGTNLSPEFHGLTKEQAPKYAFSEIFAPFTKQ
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaatatatttactaaatctatgattggtatggggctggtgtgttccgctctg
ccagcattggcaatggaagcatggaataaccaacaaggtggtaataaatatcaggttatt
ttcgatggcaaaatttatgaaaatgcctggtgggtttcttctacaaattgcccgggaaaa
gcgaaagcaaatgatgcaactaacccgtggcgtttaaagcgtaccgcaacagctgctgaa
attagtcagtttggcaatacactttcctgcgaaaagagcggcagctcatcttcttcaaat
tcaaatacgcctgcatccaatacgccggctaatggcggttcggctacaccagcacagggc
actgttccgtctaattcttctgtagttgcctggaataaacagcagggcggtcagacctgg
tatgtcgtctttaatggtgcggtatataaaaatgcctggtgggtagcctcttctaactgt
ccgggtgatgcgaaaggcaatgatgccagcaacccatggcgttatgttcgtgccgctacg
gcaacggaaatctcagaaaccagtaatccacagtcctgtacttcagcaccacagcctgca
ccggatgtgaaaccggcaccggacgttaaaccggctcctgatgttcagccagccccagct
gataagtcaaacgacaactatgctgtagtagcctggaaaggtcaggaaggttcttctaca
tggtacgttatctataacggcggcatttataagaacgcctggtgggtaggcgcggcaaat
tgcccaggcgatgcgaaagaaaacgatgccagtaacccatggcgttatgttcgcgcggca
acggcaacagaaatcagccagtatggtaaccctggctcctgttccgttaagccggataat
aatggcggtactgtgactccggttgatccaactccggaaacaccggtgaccccaactccg
gataacagcgagccatcaacaccagcggatagcggtaacgattactcattgcaagcgtgg
agcggccaggaaggtagcgaaatttaccatgttattttcaatggtaatgtttacaagaac
gcctggtgggttgggtctaaagattgcccacggggtaccagcgctgaaaactccaataac
ccatggcgtctcgagcgtacagctaccgctgcggaattgagtcagtacggtaacccgact
acctgtgaaattgataacggcggcgtcattgttgcggatggtttccaggccagcaaagcg
tacagcgcggacagcatcgtagattataacgatgcacattataaaacttctgtcgatcaa
gacgcatggggctttgtcccgggcggcgataacccgtggaagaaatacgaaccggcgaaa
gcatggtccgcatccactgtgtacgtgaaaggtgatcgcgttgttgttgatgggcaggct
tatgaagcgctgttctggacgcaaagtgacaaccctgctctggtggcgaaccaaaacgcc
accggtagcaatagccgcccgtggaagccgttaggtaaggctcagagctatagcaacgaa
gagctgaataatgcgccgcagtttaatccagaaacgctttatgccagcgatacgctgatt
cgctttaacggtgtgaactacatttctcagagtaaagtgcagaaagtttctccttctgac
agcaacccgtggcgtgtttttgttgactggaccggaaccaaagaacgtgtaggtacgccg
aagaaagcatggccgaaacacgtttatgcaccgtatgttgactttacgctgaatacgatc
ccggatttggctgcgctggctaagaatcataacgtcaaccacttcacgctggcatttgtg
gtgagtaaagatgcgaacacctgtctgccgacatggggtaccgcttatggtatgcacaat
tacgctcagtacagcaaaatcaaagctctgcgtgaggctggcggcgatgtgatgctgtct
atcggtggtgctaacaacgctccgctggctgcttcctgtaagaacgtagacgatctgatg
cagcattattatgacatcgttgataacctgaacctcaaagtcctggacttcgatatcgaa
ggcacctgggttgcggatcaggcatctattgaacgtcgtaaccttgctgtgaagaaagtg
caggataaatggaagtcagaaggcaaagatattgctatctggtacaccttgccaattctg
ccgactggcctgacgccggaagggatgaatgtcctgagcgatgccaaagcgaaaggtgtt
gagctggcgggtgtgaacgtgatgacaatggactacggtaacgcgatttgtcagtctgca
aataccgaaggccagaacattcacggtaagtgtgcaacgtctgcgattgccaacctgcat
tcacaattgaaaggcctccatcccaataagagcgatgcagaaattgacgctatgatgggt
accacgccgatggttggcgtgaacgacgttcagggcgaggtgttctatctctctgatgct
cgtctggtcatgcaggatgcgcagaagcgtaatctcggtatggttggtatctggtcaatc
gcgcgcgacctgccgggcggcactaacctgtctccggaattccacggcctgactaaagaa
caggcaccgaagtacgcatttagcgaaatcttcgcgccgtttactaagcaataa

DBGET integrated database retrieval system