KEGG   Escherichia coli B REL606: ECB_03270Help
Entry
ECB_03270         CDS       T00944                                 

Gene name
malT
Definition
(GenBank) transcriptional regulator MalT
  KO
K03556  
LuxR family transcriptional regulator, maltose regulon positive regulatory protein
Organism
ebr  Escherichia coli B REL606
Brite
Transcription factors [BR:ebr03000]
 Prokaryotic Type
  Helix-turn-helix
   LuxR family
    ECB_03270 (malT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
3481685..3484390
Genome map
AA seq 901 aa AA seqDB search
MLIPSKLSRPVRLDHTVVRERLLAKLSGANNFRLALITSPAGYGKTTLISQWAAGKNDIG
WYSLDEGDNQQERFASYLIAAVQQATNGHCAICETMAQKRQYASLTSLFAQLFIELAEWH
SPLYLVIDDYHLITNPVIHESMRFFIRHQPENLTLVVLSRNLPQLGIANLRVRDQLLEIG
SQQLAFTHQEAKQFFDCRLSSPIEAAESSRICDDVSGWATALQLIALSARQNTHSAHKSA
RRLAGINASHLSDYLVDEVLDNVDLATRHFLLKSAILRSMNDALITRVTGEENGQMRLEE
IERQGLFLQRMDDTGEWFCYHPLFGNFLRQRCQWELAAELPEIHRAAAESWMAQGFPSAA
IHHALAAGDALMLRDILLNHAWSLFNHSELSLLEESLKALPWDSLLENPQLVLLQAWLMQ
SQHRYGEVNTLLARAEHEIKDIREDTMHAEFNALRAQVAINDGNPDEAERLAKLALEELP
PGWFYSRIVATSVLGEVLHCKGELTRSLALMQQTEQMARQHDVWHYALWSLIQQSEILFA
QGFLQTAWETQEKAFQLINEQHLEQLPMHEFLVRIRAQLLWAWARLDEAEASARSGIEVL
SSYQPQQQLQCLAMLSQCSLARGDLDNARSQLNRLENLLGNGKYHSDWISNANKVRVIYW
QMTGDKAAAANWLRHTAKPEFANNHFLQGQWRNIARAQILLGEFEPAEIVLEELNENARS
LRLMSDLNRNLLLLNQLYWQAGRKSDAQRVLLDALKLANRTGFISDFVIEGEAMAQQLRQ
LIQLNTLPELEQHRAQRILREINQHHRHKFAHFDENFVERLLNHPEVPELIRTSPLTQRE
WQVLGLIYSGYSNEQIAGELEVAATTIKTHIRNLYQKLGVAHRQDAVQHAQQLLKMMGYG
V
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgctgattccgtcaaaactcagtcgtccggttcgactcgaccataccgtggttcgtgag
cgcctgctggctaaactttccggcgcgaacaacttccggctggcgctgatcacgagtcct
gcgggctacggaaagaccaccctcatttcccagtgggcggcaggcaaaaacgatatcggc
tggtactcgctggatgaaggtgataaccagcaagagcgtttcgccagctatctcattgcc
gccgtgcagcaggcaaccaacggtcactgtgcgatatgtgagacgatggcgcaaaaacgg
caatatgccagcctgacgtcactcttcgcccagcttttcattgagctggcggaatggcat
agcccactttatctggtcatcgatgactatcatctgatcactaatccagtgatccacgag
tcaatgcgcttctttattcgccatcaaccagaaaatctcaccctggtggtgttgtcacgc
aaccttccgcaactgggcattgccaatctgcgtgttcgtgatcaactgctggaaattggc
agtcagcaactggcatttacccatcaggaagcgaagcagttttttgattgccgtctgtca
tcgccgattgaagccgcagaaagcagtcggatttgcgatgacgtttccggttgggcgacg
gcactacagctaatcgccctctccgcccggcagaatacccactcagcccataagtcggca
cgccgcctggcgggaatcaatgccagccatctttcggattatctggtcgatgaggttttg
gataacgtcgatctcgcaacgcgccattttctgttgaaaagcgccattttgcgctcaatg
aacgatgcactcatcacccgtgtgaccggcgaagaaaacgggcaaatgcgcctcgaagag
attgagcgtcaggggctgtttttacagcggatggatgataccggcgagtggttctgctat
cacccgctgtttggtaacttcctgcgccagcgctgccagtgggaactggcggcggagctg
ccggaaatccaccgtgccgccgcagaaagctggatggcccagggatttcccagcgcagcg
attcatcatgcgctggcggcaggcgatgcgctgatgctgcgcgatattctgcttaatcac
gcctggagtctgttcaaccatagcgaactgtcgctgctggaagagtcgcttaaggccctg
ccgtgggacagcttgctggaaaatccgcagttggtgttattgcaggcgtggctgatgcaa
agccaacatcgctacggcgaagttaacaccctgctagcccgtgctgaacatgaaatcaag
gacatcagagaagacaccatgcacgcagaatttaacgctctgcgcgcccaggtggcgatt
aacgatggtaatccggatgaagcggaacggctggcaaaactggcactggaagagctgccg
ccgggctggttctatagccgcattgtggcaacctcggtgctgggtgaagtgctgcactgc
aaaggcgaattgacccgctcactggcgctaatgcagcaaaccgaacagatggcacgccag
cacgatgtctggcactacgctttgtggagtttaatccagcaaagtgaaattctgtttgcc
caagggttcctgcaaaccgcgtgggaaacgcaggaaaaagcattccagctgatcaacgag
cagcatctggaacagctgccaatgcatgagtttctggtgcgcatccgagcacaactgtta
tgggcctgggcgcggctggatgaagccgaagcgtcggcgcgtagcgggattgaagtcttg
tcgtcttatcagccacagcaacagcttcagtgcctggcaatgttgagtcaatgctcgctg
gcccgtggtgatttagataacgcccgtagccagctgaaccgtctggaaaatctgctgggg
aatggcaaatatcacagcgactggatctctaacgccaacaaagtccgggtgatttactgg
caaatgaccggtgataaagccgccgctgccaactggttgcgtcatacggctaaaccggag
tttgcgaacaaccacttcctgcaaggtcaatggcgcaacattgcccgtgcacaaatcttg
ctgggcgagtttgaacctgcggaaattgttctcgaagaactcaatgaaaatgcccggagt
ctgcggttgatgagcgatctcaaccgtaacctgttgctgcttaatcaactgtactggcag
gccggacgtaaaagtgacgcccagcgcgtgttgctggacgcattaaaactggcgaatcgc
accggatttatcagcgattttgtcatcgaaggcgaagcgatggcgcaacaactgcgtcag
ctgattcagcttaatacgctgccggaactggaacagcatcgcgcgcagcgtattctgcga
gaaatcaatcaacatcatcggcataaattcgcccatttcgatgagaatttcgttgaacgt
ctgctaaatcatcctgaagtacctgaactgatccgcaccagcccgctgacgcaacgtgaa
tggcaggtactggggctgatctactctggttacagcaatgagcaaattgccggagaactg
gaagtcgcggcaaccaccatcaaaacgcatatccgcaatctgtatcagaaactcggcgtg
gcccatcgccaggatgcggtacaacacgcccagcaattgctgaagatgatggggtacggc
gtgtaa

DBGET integrated database retrieval system