KEGG   Escherichia coli B REL606: ECB_03272Help
Entry
ECB_03272         CDS       T00944                                 

Gene name
rtcB
Definition
(GenBank) hypothetical protein
  KO
K14415  
tRNA-splicing ligase RtcB [EC:6.5.1.3]
Organism
ebr  Escherichia coli B REL606
Brite
Enzymes [BR:ebr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.3  RNA ligase (ATP)
     ECB_03272 (rtcB)
Transfer RNA biogenesis [BR:ebr03016]
 Eukaryotic Type
  tRNA spricing factors
   tRNA splicing ligases
    ECB_03272 (rtcB)
 Prokaryotic Type
    ECB_03272 (rtcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3485453..3486679)
Genome map
AA seq 408 aa AA seqDB search
MNYELLTTENAPVKMWTKGVPVEADARQQLINTAKMPFIFKHIAVMPDVHLGKGSTIGSV
IPTKGAIIPAAVGVDIGCGMNALRTALTAADLPENLAELRQAIETAVPHGRTTGRCKRDK
GAWENPPVNVDAKWAELEAGYQWLTQKYPRFLNTNNYKHLGTLGTGNHFIEICLDESEQV
WIMLHSGSRGIGNAIGTYFIALAQKEMQETLETLPSRDLAYFMEGTEYFDDYLKAVAWAQ
LFASLNRDAMMENVVTALQSITQKTVRQPQTLAMEEINCHHNYVQKEQHFGEEIYVTRKG
AVSARAGQYGIIPGSMGAKSFIVRGLGNEESFCSCSHGAGRVMSRTKAKKLFSVEDQIRA
TAHVECRKDAEVIDEIPMAYKDIDAVMAAQSDLVEVIYTLRQVVCVKG
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgaattactgaccactgaaaatgccccggtaaaaatgtggaccaaaggcgtg
ccggtagaagccgatgcgcgtcagcaacttattaatacggcgaagatgccgtttattttc
aaacacattgcggtaatgcctgatgtacacctgggtaaaggttccaccattggtagcgtg
atcccgaccaaaggggcgattattccggcggcggtgggcgtggatattggctgtggaatg
aacgcgctgcgtaccgcgttaacggcggcagacctgcctgaaaacctggcagagctgcgt
caggcgattgaaacggccgtgccgcacgggcgtaccactggccgttgtaaacgtgataaa
ggcgcatgggaaaacccgcctgttaacgtcgatgcgaaatgggctgagcttgaagccggt
tatcagtggttaacgcaaaaatatccccgtttcctgaataccaataactataaacacctg
ggaacgctgggaaccggtaaccactttattgaaatctgccttgatgagtcggagcaggtg
tggattatgctgcactccggttcacgcggaattggtaacgccatcgggacttactttatc
gctctggcacaaaaagagatgcaggaaacgcttgagacgttgccgtcgcgtgatctggcg
tactttatggaaggtacggaatactttgatgattacctgaaagccgtggcctgggcgcag
ctttttgccagccttaaccgcgatgcgatgatggaaaacgtggtaacggcattgcagagc
attacgcagaaaacggtcagacagccacaaacgctggcgatggaagagatcaactgtcac
cacaactatgtgcaaaaagaacagcactttggtgaagagatctacgtgacgcgtaaaggc
gcggtgtctgcgcgtgctggtcaatatggaattattcccggttcgatgggagcgaaaagc
tttatcgtccgtgggttgggaaatgaagagtcgttctgttcgtgcagccacggtgccggg
cgggtaatgagccgtactaaagcgaaaaaactgttcagcgtggaagatcaaattcgtgcc
accgcgcatgtggaatgccgtaaagatgccgaagtgatcgacgaaatcccgatggcgtat
aaagatattgatgcggtgatggcggcacaaagcgatctggtggaagttatctacaccctg
cgtcaggtggtgtgcgtaaaaggataa

DBGET integrated database retrieval system