KEGG   Escherichia coli B REL606: ECB_03283Help
Entry
ECB_03283         CDS       T00944                                 

Gene name
glgX
Definition
(GenBank) glycogen debranching enzyme
  KO
K02438  
glycogen debranching enzyme [EC:3.2.1.196]
Organism
ebr  Escherichia coli B REL606
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECB_03283 (glgX)
Enzymes [BR:ebr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.196  limit dextrin alpha-1,6-maltotetraose-hydrolase
     ECB_03283 (glgX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(3500800..3502773)
Genome map
AA seq 657 aa AA seqDB search
MTQLAIGKPAPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGY
LPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGHNEPDYR
DNAAIAPKCVVVVDHYDWEDDAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALG
HPVMINYLKQLGITALELLPVAQFASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETA
LHEFRDAIKALHKAGIEVILDIVLNHSAELDLDGPLFSLRGIDNRSYYWIREDGDYHNWT
GCGNTLNLSHPAVVDYACACLRYWVETCHVDGFRFDLAAVMGRTPEFRQDAPLFTAIQNC
PVLSQVKLIAEPWDIAPGGYQVGNFPPLFAEWNDHFRDAARRFWLHYDLPLGAFAGRFAA
SSDVFKRNGRLPSAAINLVTAHDGFTLRDCVCFNHKHNEANGEENRDGTNNNYSNNHGKE
GLGGTLDLVERRRDSIHALLTTLLLSQGTPMLLAGDEHGHSQHGNNNAYCQDNQLTWLDW
SQASSGLTAFTAALIHLRKRIPALVENRWWEEGDGNVRWLNRYAQPLSTDEWQNGPKQLQ
ILLSDRFLIAINATLEVTEIVLPAGEWHAIPPFAGEDNPVITAVWQGPAHGLCVFQR
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgacacaactcgccattggcaaacccgctcccctcggcgcgcattacgacggtcagggc
gtcaacttcacacttttctccgctcatgccgagcgggtagagctgtgtgtctttgacgcc
aatggccaggaacatcgctatgacttgccagggcacagtggcgacatttggcacggttat
ctgccggatgcgcgcccgggtttgcgttatggttatcgcgttcatggcccctggcaaccc
gccgaggggcatcgctttaacccggcgaagttgttgattgatccttgcgcgcggcaaatt
gacggggaattcaaagataacccgctgctgcacgccggtcataatgaacctgactatcgc
gacaacgccgccattgcgccgaaatgcgtagtggtggttgatcactatgactgggaagat
gatgccccgccgcgcacgccgtggggcagcaccatcatttatgaagcccatgttaaagga
ttaacgtacctgcacccggagatcccggtcgagatccgtggcacttataaagccctggga
catccggtgatgatcaactatttgaaacaattgggcattaccgcgctggaactgctgcca
gtggcgcagtttgccagtgaaccacgtctgcaacgcatggggctaagtaactactggggt
tacaacccggtggcgatgtttgcgctgcatccggcgtatgcctgctcgccagaaacggcg
ctgcatgagtttcgcgatgcaatcaaagcactgcataaagcgggtatcgaagtcattctt
gatatcgtgctcaaccatagtgcggaactggacctcgacggcccgttattctcgctgcgt
gggatcgacaaccgtagctattattggataagagaagacggcgattatcacaactggacc
ggttgtggcaacacgctcaatttgagtcatccggcggtggtggattatgcctgcgcctgc
ctgcgttattgggtagaaacctgtcacgtcgatggtttccgctttgatctggcggcagtc
atgggccgtacgccagagttccgtcaggatgcgccgttgtttaccgctatccagaactgc
ccggtgctctcgcaggtgaagttaattgctgaaccgtgggatatcgctcctggtggttat
caggtgggaaatttcccgccgctgtttgccgagtggaacgatcatttccgcgatgctgcc
cgtcgtttctggctacattatgatttgcctctgggggcgtttgccgggcgttttgctgcc
tccagcgatgtttttaaacgtaatggtcgtctgccgagtgccgcgattaatctcgtcacc
gcgcatgacggttttacgcttcgcgactgcgtttgcttcaaccataaacacaatgaagca
aacggagaagaaaatcgcgacgggaccaacaacaattacagtaacaatcatggtaaagaa
gggttaggcggtactcttgatctggttgaacggcggcgcgacagcattcatgccctgtta
acaacgttgttgctctcccagggcacgccgatgttactggccggtgacgaacatggtcac
agccagcatggcaataacaatgcctactgtcaggataaccaattaacctggttggactgg
tcgcaggcaagcagtggtttaaccgcatttaccgccgcgttaatccatctgcgcaagcgt
attcccgctttggtggagaatcgctggtgggaagaaggcgacggcaatgtccgttggcta
aatcgatatgctcaacctttaagcacggatgagtggcaaaacgggccgaaacagctgcaa
attctgctctcggatcgctttttgatcgcaattaacgccacgcttgaggtaacagagatt
gttttacctgctggggagtggcacgccattcccccattcgctggagaggataacccagtg
attacggctgtctggcagggacctgcacacggattgtgtgtgttccagagatga

DBGET integrated database retrieval system