KEGG   Escherichia coli B REL606: ECB_03286Help
Entry
ECB_03286         CDS       T00944                                 

Gene name
yhgN
Definition
(GenBank) predicted antibiotic transporter
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
3506524..3507117
Genome map
AA seq 197 aa AA seqDB search
MNEIISAAVLLILIMDPLGNLPIFMSVLKHTEPKRRRAIMVRELLIALLVMLVFLFAGEK
ILAFLSLRAETVSISGGIILFLIAIKMIFPSASGNSSGLPAGEEPFIVPLAIPLVAGPTI
LATLMLLSHQYPNQMGHLVIALLLAWGGTFVILLQSSLFLRLLGEKGVNALERLMGLILV
MMATQMFLDGIRMWMKG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaatcatttctgcagcagttttattgatcctgattatggatccgctcggaaac
ctacctattttcatgtccgtactgaaacatactgaaccgaaaagacggcgggcaatcatg
gtgcgagagttgcttattgctctcctggtgatgctggtgttcctgtttgcgggtgagaaa
attctggcatttctcagcctacgagcagaaaccgtctccatttctggcggcatcattctg
tttctaattgccattaagatgattttccccagcgcttcaggaaatagcagcgggcttccg
gcaggtgaagagccatttatcgtgccgctggcaattccgctggtcgccgggccaactatt
ctcgccacgctgatgttgttgtctcatcagtacccgaatcagatgggacatctggtgatt
gctctgctgctggcctggggcggcacctttgtcatcctgctacagtcttcgctattttta
cgtctgctgggcgagaaaggggtgaacgcacttgaacgcctgatgggattgattctggtg
atgatggcaacccagatgttcctcgacggcattcgaatgtggatgaaggggtaa

DBGET integrated database retrieval system