KEGG   Escherichia coli B REL606: ECB_03291Help
Entry
ECB_03291         CDS       T00944                                 

Gene name
yhhX
Definition
(GenBank) predicted oxidoreductase with NAD(P)-binding Rossmann-fold domain
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(3511221..3512258)
Genome map
AA seq 345 aa AA seqDB search
MVINCAFIGFGKSTTRYHLPYVLNRKDSWHVAHIFRRHAKPEEQAPIYSHIHFTSDLDEV
LNDPDVKLVVVCTHADSHFEYAKRALEAGKNVLVEKPFTPTLAQAKELFALAKSKGLTVT
PYQNRRFDSCFLTAKKAIESGKLGEIVEVESHFDYYRPVAETKPGLPQDGAFYGLGVHTM
DQIISLFGRPDHVAYDIRSLRNKANPDDTFEAQLFYGDLKAIVKTSHLVKIDYPKFIVHG
KKGSFIKYGIDQQETSLKANIMPGEPGFAADDSVGVLEYVNDEGVTVREEMKPEMGDYGR
VYDALYQTITHGAPNYVKESEVLTNLEILERGFEQASPSTVTLAK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcaactgcgcctttattggcttcggcaaaagcaccacccgttaccatctgccg
tatgtacttaaccgcaaggatagctggcatgtcgcgcatatttttcgtcgccatgcgaag
ccggaagaacaggctcccatttattcccatatccatttcaccagcgatctcgacgaagta
ctaaacgatcccgatgttaagctggttgttgtctgcacccacgcggacagccatttcgag
tacgcgaaacgcgcgctggaagccgggaaaaatgtgctggtcgaaaaaccgttcaccccg
acgcttgcccaggcgaaggagctgtttgcgttggcgaaaagcaaagggctgaccgtcacg
ccgtatcagaatcgtcgctttgactcctgcttcctgacagcgaaaaaagcgattgaaagt
ggcaagttgggagagattgttgaagtggaaagccattttgactattaccgcccggtggca
gaaaccaaacctgggctgccgcaggatggcgcgttttatggccttggtgtgcatacgatg
gaccagattatttctctgttcggtcgcccggatcacgtcgcttatgacatccgcagcctg
cgtaataaagccaatcctgacgacacctttgaagcgcaactgttttatggcgacctgaaa
gccatcgtcaaaaccagccatctggtgaaaatcgattatccgaaatttatcgttcacggt
aagaaaggttcgtttattaaatacggtatcgaccagcaggaaaccagcctgaaggctaat
attatgccgggcgaaccgggattcgcagcggatgattcggtcggtgtgctggagtatgtc
aatgacgagggcgtgacggtcagagaagagatgaagccggagatgggcgattacgggcgc
gtttatgatgcgttgtatcaaaccatcacccacggtgcgccaaattacgtcaaggaatct
gaagttcttaccaatctggaaatccttgaacgcggatttgagcaagcctctccctccaca
gtgactctcgcgaagtaa

DBGET integrated database retrieval system