KEGG   Escherichia coli B REL606: ECB_03294Help
Entry
ECB_03294         CDS       T00944                                 

Gene name
yrhA
Definition
(GenBank) hypothetical protein
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
3514494..3514985
Genome map
AA seq 163 aa AA seqDB search
MTKTQINKLIKMMNDLDYPFEAPLKESFIESIIQIEFNSNSTNCLEKLCNEVSILFKNQP
DYLTFLRAMDGFEVNGLRLFSLSIPEPSVKNLFAVNEFYRNNDDFINPDLQERLVIGDDS
ISIFTYDIKSNFFEIRDNIGTENIFSSFSDFSSFLNEIMDSCS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacccaaataaataaattaataaaaatgatgaatgatttagactatccattt
gaagcaccgctcaaggaatcatttattgaaagtataatccaaatagaatttaattctaat
tcaactaattgcctggagaagttatgtaatgaagttagtattctttttaagaatcaacct
gattatcttacttttttaagagcaatggatggattcgaagttaatggattacgattattt
agcctctcgattccagaaccttcagttaaaaacctttttgccgtaaatgaattttataga
aataatgatgatttcataaaccctgatctacaagaacggttagtgatcggggatgatagc
atttcaatatttacttatgacattaaaagtaacttttttgaaattagagataatattggc
acagaaaatatattcagttcgtttagtgatttctcttcattcttaaacgaaatcatggac
agttgttcataa

DBGET integrated database retrieval system