KEGG   Escherichia coli B REL606: ECB_03295Help
Entry
ECB_03295         CDS       T00944                                 

Gene name
yrhB
Definition
(GenBank) hypothetical protein
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
3515435..3515719
Genome map
AA seq 94 aa AA seqDB search
MITYHDAFAKANHYLDDADLPVVITLHGRFSQGWYFCFEAREFLETGDEAARLAGNAPFI
IDKDSGEIHSLGTAKPLEEYLQDYEIKKATFGLP
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgattacttatcacgacgcattcgcgaaagcgaaccattaccttgatgatgcagatctc
ccggtcgtcattactctacatggacgctttagccagggctggtatttctgtttcgaagca
cgagaatttctcgaaactggagatgaggccgcgcgcttagctggtaacgcaccttttatt
attgataaagacagtggtgaaattcattctctgggaacggcaaagccgctggaagaatat
ctacaggattacgaaataaaaaaggctaccttcggcttgccctga

DBGET integrated database retrieval system