KEGG   Escherichia coli B REL606: ECB_03299Help
Entry
ECB_03299         CDS       T00944                                 

Gene name
ugpC
Definition
(GenBank) glycerol-3-phosphate transporter subunit
  KO
K05816  
sn-glycerol 3-phosphate transport system ATP-binding protein [EC:3.6.3.20]
Organism
ebr  Escherichia coli B REL606
Pathway
ABC transporters
Module
Putative sn-glycerol-phosphate transport system
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    ECB_03299 (ugpC)
Enzymes [BR:ebr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.20  glycerol-3-phosphate-transporting ATPase
     ECB_03299 (ugpC)
Transporters [BR:ebr02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198] [OT]
    ECB_03299 (ugpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3518786..3519856)
Genome map
AA seq 356 aa AA seqDB search
MAGLKLQAVTKSWDGKTQVIKPLTLDVADGEFIVMVGPSGCGKSTLLRMVAGLERVTEGD
IWINDQRVTEMEPKDRGIAMVFQNYALYPHMSVEENMAWGLKIRGMGKQQIAERVKEAAR
ILELDGLLKRRPRELSGGQRQRVAMGRAIVRDPAVFLFDEPLSNLDAKLRVQMRLELQQL
HRRLKTTSLYVTHDQVEAMTLAQRVMVMNGGVAEQIGTPVEVYEKPASLFVASFIGSPAM
NLLTGRVNNEGTHFELDGGIELPLNGGYRQYAGRKMTLGIRPEHIALSSQAEGGVPMVMD
TLEILGADNLAHGRWGEQKLVVRLAHQERPTAGSTLWLHLAENQLHLFDGETGQRV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcaggactgaaattacaggcagtaaccaaaagctgggatggtaaaacccaggtcatt
aaaccgctgacccttgatgtggcggatggcgaatttatcgtgatggtcgggccgtctggc
tgcgggaaatcgacgctgctgcgcatggttgccgggctggagcgggtgacagaaggcgat
atctggatcaacgaccagcgcgtgactgaaatggagccaaaagatcgcgggattgcgatg
gtgttccagaactacgcgctttatccgcatatgagtgtcgaagaaaacatggcgtggggg
ctgaaaattcgcggcatgggcaagcagcaaattgccgagcgcgttaaagaagcggcgcgc
attctggagctggacggtctgctcaaacgtcgcccgcgcgagctttccggcggtcagcgc
cagcgtgtggcgatgggccgcgcgattgtgcgcgatccggcggtgttcctgtttgatgag
ccgctctctaacctcgatgccaagctgcgcgtgcagatgcgtcttgaactgcaacagttg
caccgtcgcctgaaaacgacttcactctacgttactcacgatcaggttgaagcgatgacg
ctcgcccagcgagtaatggtgatgaacggcggcgttgccgaacagattggcacaccagtt
gaagtctacgaaaagcccgccagcctgtttgtagcgagttttatcggcagtccggcgatg
aacctgctgacaggccgcgtgaataacgaaggcacgcatttcgaactggacggcggtatt
gagctgccgctaaacggtggctaccgtcagtatgccgggcgtaaaatgactctcggcatt
cgcccggaacatattgcgctaagctcgcaggcagaaggcggcgtaccgatggtgatggac
acgctggagatcctcggcgcagataacctggcgcacggacgctggggcgagcagaagctg
gtggtgcgactggcgcatcaggagcgcccgacggcaggcagcacgctgtggctgcatctg
gcggaaaatcagctgcatctttttgatggtgaaacaggacaacgagtatga

DBGET integrated database retrieval system