KEGG   Escherichia coli B REL606: ECB_03302Help
Entry
ECB_03302         CDS       T00944                                 

Gene name
ugpB
Definition
(GenBank) glycerol-3-phosphate transporter subunit
  KO
K05813  
sn-glycerol 3-phosphate transport system substrate-binding protein
Organism
ebr  Escherichia coli B REL606
Pathway
ABC transporters
Module
Putative sn-glycerol-phosphate transport system
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    ECB_03302 (ugpB)
Transporters [BR:ebr02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198] [OT]
    ECB_03302 (ugpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(3521685..3523001)
Genome map
AA seq 438 aa AA seqDB search
MKPLHYTASALALGLALMGNAQAVTTIPFWHSMEGELGKEVDSLAQRFNAENPDYKIVPT
YKGNYEQNLSAGIAAFRTGNAPAILQVYEVGTATMMASKAIKPVYDVFKEAGIQFDESQF
VPTVSGYYSDSKTGHLLSQPFNSSTPVLYYNKDAFKKAGLDPEQPPKTWQDLADYAAKLK
ASGMKCGYASGWQGWIQLENFSAWNGLPFASKNNGFDGTDAVLEFNKPEQVKHIAMLEEM
NKKGDFSYVGRKDESTEKFYNGDCAMTTASSGSLANIREYAKFNYGVGMMPYDADAKDAP
QNAIIGGASLWVMQGKDKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITKAAYDLTREQ
GFYEKNPGADTATRQMLNKPPLPFTKGLRLGNMPQIRVIVDEELESVWTGKKTPQQALDT
AVERGNQLLRRFEKSTKS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgttacattatacagcttcagcactggcgctcggactggcgttaatggggaat
gcacaggcagtgacgaccattccgttctggcattctatggaaggggaactgggtaaagag
gtggattctctggcccaacgttttaacgccgaaaatccggattacaaaattgtaccgacc
tataaaggcaactacgaacagaatttaagcgcggggattgccgcatttcgtaccggcaac
gctccggctattttgcaggtttatgaagttggcaccgccaccatgatggcatcgaaagcc
attaaaccggtatatgacgtgtttaaagaggcggggattcaattcgatgagtcgcagttt
gtgccgacggtttccggttactactccgacagcaaaacgggccacttactctcccagcca
ttcaacagctcgacccccgttctctattacaacaaagacgccttcaagaaagcaggatta
gacccggaacaaccgccgaaaacctggcaggatctggcggactatgccgcgaaactgaaa
gcctccggtatgaagtgcggctacgccagcggctggcagggctggatccaactggaaaac
tttagcgcctggaacggtctgccgtttgccagcaaaaacaacggctttgacggcacggac
gcggtgctggagttcaacaagccggagcaggtgaaacacatcgccatgctcgaggagatg
aacaagaagggcgacttcagctacgtcggtcgtaaggatgaatccaccgagaagttctat
aacggtgattgcgcgatgaccaccgcctcttccggttctcttgccaacattcgcgagtac
gccaaatttaactacggcgtaggcatgatgccttacgacgccgatgcgaaagatgcgcca
caaaacgccattatcggcggagccagcctgtgggtgatgcagggtaaagataaagaaacg
tataccggtgtggcgaagttcctcgatttcctcgcgaagccagaaaacgctgccgagtgg
catcagaaaaccggttatctgccaatcaccaaagcagcgtatgacctgacccgtgagcag
ggcttttatgagaaaaacccaggggcggataccgcgacgcgtcagatgctgaataagccg
ccgttgccgttcaccaaagggctgcgtctgggcaacatgccgcagatccgcgtgattgtg
gatgaagagctggagagcgtgtggaccggtaagaagacaccacagcaggcactggatacc
gccgttgagcgtggaaatcagttgctgcgccgctttgagaaatcgacgaagtcttaa

DBGET integrated database retrieval system