KEGG   Escherichia coli B REL606: ECB_03310Help
Entry
ECB_03310         CDS       T00944                                 

Gene name
rpoH
Definition
(GenBank) RNA polymerase sigma factor
  KO
K03089  
RNA polymerase sigma-32 factor
Organism
ebr  Escherichia coli B REL606
Brite
Transcription machinery [BR:ebr03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     ECB_03310 (rpoH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3530614..3531468)
Genome map
AA seq 284 aa AA seqDB search
MTDKMQSLALAPVGNLDSYIRAANAWPMLSADEERALAEKLHYHGDLEAAKTLILSHLRF
VVHIARNYAGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSFAVHWIKAEIHEYVLRN
WRIVKVATTKAQRKLFFNLRKTKQRLGWFNQDEVEMVARELGVTSKDVREMESRMAAQDM
TFDLSSDDDSDSQPMAPVLYLQDKSSNFADGIEDDNWEEQAANRLTDAMQGLDERSQDII
RARWLDEDNKSTLQELADRYGVSAERVRQLEKNAMKKLRAAIEA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaaaatgcaaagtttagctttagccccagttggcaacctggattcctacatc
cgggcagctaacgcgtggccgatgttgtcggctgacgaggagcgggcgctggctgaaaag
ctgcattaccatggcgatctggaagcagctaaaacgctgatcctgtctcacctgcggttt
gttgttcatattgctcgtaattatgcgggctatggcctgccacaggcggatttgattcag
gaaggtaacatcggcctgatgaaagcagtgcgccgttttaacccggaagtgggtgtgcgc
ctggtctccttcgccgttcactggatcaaagcagagatccacgaatacgtcctgcgtaac
tggcgtatcgtcaaagttgcgaccaccaaagcgcagcgcaaactgttcttcaacctgcgt
aaaaccaagcagcgtctgggctggtttaaccaggatgaagtcgaaatggtggcccgtgaa
ctgggcgtaaccagcaaagacgttcgtgagatggaatcacgtatggcggcacaggacatg
acctttgacctgtcttccgacgacgattccgacagccagccgatggcaccggtgctctat
ctgcaggataaatcatctaactttgccgacggcatcgaagatgataactgggaagagcag
gcggcaaaccgtctgaccgacgcgatgcagggtctggacgaacgcagccaggacatcatc
cgtgcgcgctggctggacgaagacaacaagtccacgttgcaggaactggctgaccgttac
ggtgtttccgctgaacgtgtgcgccaactggaaaagaacgcgatgaaaaaattgcgtgct
gctatagaagcgtaa

DBGET integrated database retrieval system