KEGG   Escherichia coli B REL606: ECB_03314Help
Entry
ECB_03314         CDS       T00944                                 

Gene name
yhhF
Definition
(GenBank) predicted methyltransferase
  KO
K08316  
16S rRNA (guanine966-N2)-methyltransferase [EC:2.1.1.171]
Organism
ebr  Escherichia coli B REL606
Brite
Enzymes [BR:ebr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.171  16S rRNA (guanine966-N2)-methyltransferase
     ECB_03314 (yhhF)
Ribosome biogenesis [BR:ebr03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    ECB_03314 (yhhF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
3535081..3535677
Genome map
AA seq 198 aa AA seqDB search
MKKPNHSGSGQIRIIGGQWRGRKLPVPDSPGLRPTTDRVRETLFNWLAPVIVDAQCLDCF
AGSGALGLEALSRYAAGATLIEMDRVVSQQLIKNLATLKAGNVRVVNSNAMSFLAQKGTP
HNIVFVDPPFRRGLLEETINLLEDNGWLADEALIYVESEVENGLPTVPANWSLHREKVAG
QVAYRLYQREAQGESDAD
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaccgaatcattccggcagcggccaaatccgcattattggcgggcagtggcga
ggccgtaaactcccggttcctgatagtccaggtctgcgccccaccaccgaccgcgtacgc
gaaacgttgtttaactggctggctccggtcattgttgacgcccaatgtctggattgcttc
gccggaagcggcgcgctggggctggaagcgttatcgcgctacgctgcgggggcaacgttg
attgagatggatcgcgtggtttctcagcagttaattaagaatctggcgacactaaaagca
ggcaatgtacgcgtggtgaacagcaacgcaatgtcattcctggcgcaaaaaggcacaccg
cataatatcgtgtttgtcgatccaccgttccgccgtggcttgttagaagagacgataaat
ttactggaagataacggctggctggctgacgaagccctgatttatgtcgaaagcgaagtc
gaaaacggtctgcccactgttccggcaaactggtcattgcatcgggaaaaagtggcgggt
caggtggcttatcggctgtatcaacgcgaagcacaaggagaaagtgatgctgattaa

DBGET integrated database retrieval system