KEGG   Escherichia coli B REL606: ECB_03323Help
Entry
ECB_03323         CDS       T00944                                 

Gene name
yhhT
Definition
(GenBank) predicted inner membrane protein
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3542553..3543602
Genome map
AA seq 349 aa AA seqDB search
METPQPDKTGMHILLKLASLVVILAGIHAAADIIVQLLLALFFAIVLNPLVTWFIRRGVQ
RPVAITIVVVVMLIALTALVGVLAASFNEFISMLPKFNKELTRKLFKLQEMLPFLNLHMS
PERMLQRMDSEKVVTFTTALMTGLSGAMASVLLLVMTVVFMLFEVRHVPYKMRFALNNPQ
IHIAGLHRALKGVSHYLALKTLLSLWTGVIVWLGLELMGVQFALMWAVLAFLLNYVPNIG
AVISAVPPMIQVLLFNGVYECILVGALFLVVHMVIGNILEPRMMGHRLGMSTMVVFLSLL
IWGWLLGPVGMLLSVPLTSVCKIWMETTKGGSKLAILLGPGRPKSRLPG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggaaacccctcaacccgataaaacgggcatgcacattctgctcaagctggcctcgctg
gtagtgatcctcgcgggcattcacgcagcggcagatatcattgtgcagctgttactggcg
ctgttttttgccatcgtcctcaacccgctcgtcacctggtttattcgtcggggagtacaa
cgccccgttgccattacgattgtagtggtggtgatgctgatcgcactaaccgcgctggtc
ggcgtactggcggcatcgtttaacgaatttatctctatgctgccgaagtttaataaggag
ctgacgcgcaaactttttaaattgcaggagatgttgccttttcttaatttgcatatgtcg
ccggagcgaatgctgcagcggatggactcggaaaaagtggttaccttcaccacagcgcta
atgaccgggctttccggggcaatggcgagcgtgcttttgctggtgatgaccgtagttttt
atgctgtttgaagtgcgccacgtcccttacaaaatgcgttttgcgctgaataatccacag
attcacatcgcgggattacaccgcgcacttaaaggcgtttcgcactatcttgcattgaag
acgctactcagtttatggacaggtgtcatcgtctggctggggctggagctgatgggggtg
cagtttgcgctgatgtgggcagtactggcgtttttgctcaactacgtgcccaatatcggc
gcggtaatttccgccgtaccgccaatgattcaggtgctgctgtttaatggtgtttacgaa
tgtattctggtcggcgcattgtttttagtggtccatatggtcatcggcaatattttagaa
ccacggatgatgggccatcgcctggggatgtccaccatggtggtatttctttcattgtta
atttggggatggctgctcggcccggtagggatgctactttcggtgccattaaccagcgtg
tgtaaaatctggatggaaaccaccaaaggcggtagcaaactggcgattttactggggccg
ggcagaccgaaaagtcggttaccgggatga

DBGET integrated database retrieval system