KEGG   Escherichia coli B REL606: ECB_03324Help
Entry
ECB_03324         CDS       T00944                                 

Gene name
acpT
Definition
(GenBank) holo-(acyl carrier protein) synthase 2
  KO
K06133  
4'-phosphopantetheinyl transferase [EC:2.7.8.-]
Organism
ebr  Escherichia coli B REL606
Pathway
Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ECB_03324 (acpT)
Enzymes [BR:ebr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     ECB_03324 (acpT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
3543657..3544244
Genome map
AA seq 195 aa AA seqDB search
MYRIVLGKVSTLSAAPLPPGLREQAPQGPRRERWLAGRALLSHTLSPLPEIIYGEQGKPA
FAPEMPLWFNLSHSGDDIALLLSDEGEVGCDIEVIRPRANWRWLANAVFSLGEHAEMDAV
HPDQQLEMFWRIWTRKEAIVKQRGGSAWQIVSVDSTYHSSLSVSHCQLENLSLAICTPTP
FTLTADSVPWIDSVN
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtatcggatagttctggggaaagtttcgaccttaagcgcagctccactgccaccgggt
ttacgcgagcaagcaccgcaaggtccacgacgcgaacgctggctggcggggcgtgcattg
ctttcgcacacgctttccccgctaccggagatcatctatggcgaacaaggcaaacctgca
tttgcgccggaaatgccgctatggttcaacttaagccatagcggtgacgatatcgccctg
ctgttgagtgatgaaggcgaagtcggctgcgatatcgaagtgattcgcccgcgcgccaac
tggcgctggctggcgaacgccgtattcagcctcggggaacacgctgagatggacgccgtg
catcctgatcagcaactggaaatgttctggcgcatctggacgcgcaaagaagccatcgtt
aaacagcgtggcggcagcgcctggcaaatcgtcagcgtagacagcacctatcactcctcg
ctgtcagtcagccattgtcagcttgaaaatttaagccttgcgatctgcacccctactccc
tttacgctcaccgccgacagtgtgccatggatcgattcagttaactga

DBGET integrated database retrieval system