KEGG   Escherichia coli B REL606: ECB_03327Help
Entry
ECB_03327         CDS       T00944                                 

Gene name
nikC
Definition
(GenBank) nickel transporter subunit
  KO
K15586  
nickel transport system permease protein
Organism
ebr  Escherichia coli B REL606
Pathway
ABC transporters
Module
Nickel transport system
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    ECB_03327 (nikC)
Transporters [BR:ebr02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Nickel transporter [MD:M00440] [OT]
    ECB_03327 (nikC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3546870..3547703
Genome map
AA seq 277 aa AA seqDB search
MNFFLSSRWSVRLALIIIALLALIALTSQWWLPYDPQAIDLPSRLLSPDAQHWLGTDHLG
RDIFSRLMAATRVSLGSVMACLLLVLTLGLVIGGSAGLIGGRVDQATMRVADMFMTFPTS
ILSFFMVGVLGTGLTNVIIAIALSHWAWYARMVRSLVISLRQREFVLASRLSGAGHVRVF
VDHLAGAVIPSLLVLATLDIGHMMLHVAGMSFLGLGVTAPTAEWGVMINDARQYIWTQPL
QMFWPGLALFISVMAFNLVGDALRDHLDPHLVTEHAH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgaactttttcctctcttcccgctggtcggtacgcctggcgctgatcattatcgccctg
ctggcgctgattgcgctcaccagccagtggtggctgccgtatgacccccaggcgattgat
ttgccgtcgcgcctgctttcgccggatgcgcagcactggctgggcaccgatcacttaggt
cgcgatattttctcgcggctgatggcagcgacccgcgtgtcgctcggttcggtaatggcc
tgcctgctgctggtgctgacattagggctggttattggcggcagcgccgggttgattggc
gggcgcgttgatcaggccaccatgcgcgtcgccgatatgtttatgaccttcccgacctcg
attctgtcgttctttatggttggcgtgctcggcaccgggctgaccaacgtaattatcgcc
atcgccctgtcgcactgggcgtggtatgcacgcatggtgcgcagcctggtgatttcactg
cgccagcgcgagtttgtgctggcatcacggctttctggcgcaggccatgtgcgggtgttt
gttgatcatctggcaggcgcggtgatcccttcgctgctggtgctggcaacgctggatatc
ggccatatgatgctgcacgtcgcggggatgtctttccttggcctcggtgtgaccgcgccg
accgccgaatggggcgtgatgattaacgacgcgcgccagtatatctggacccagccgctg
caaatgttctggccggggctggcgctgtttatcagcgtgatggcctttaacctggtgggt
gacgcactgcgcgatcatctggaccctcatctggtgacggagcacgcacactaa

DBGET integrated database retrieval system