KEGG   Escherichia coli B REL606: ECB_03328Help
Entry
ECB_03328         CDS       T00944                                 

Gene name
nikD
Definition
(GenBank) nickel transporter subunit
  KO
K15587  
nickel transport system ATP-binding protein [EC:3.6.3.24]
Organism
ebr  Escherichia coli B REL606
Pathway
ABC transporters
Module
Nickel transport system
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    ECB_03328 (nikD)
Enzymes [BR:ebr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.24  nickel-transporting ATPase
     ECB_03328 (nikD)
Transporters [BR:ebr02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Nickel transporter [MD:M00440] [OT]
    ECB_03328 (nikD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3547703..3548467
Genome map
AA seq 254 aa AA seqDB search
MPQQIELRNIALQAAQPLVHGVSLTLQRGRVLALVGGSGSGKSLTCAATLGILPAGVRQT
AGEILADGKPVSPCALRGIKIATIMQNPRSAFNPLHTMHTHARETCLALGKPADDATLTA
AIEAVGLENAARVLKLYPFEMSGGMLQRMMIAMAVLCESPFIIADEPTTDLDVVAQARIL
DLLESIMQKQAPGMLLVTHDMGVVARLADDVAVMSQGKIVEQGDVETLFNAPKHTVTRSL
VSAHLALYGMELAS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaacagattgaactacgtaatatcgcgctacaggccgcgcagccgctggtacac
ggtgtatcgttaaccctgcaacgcgggcgcgtgctggcgttagtcggcggtagcggcagc
gggaaatcattaacctgcgccgcgacgctgggcattttgcccgctggcgttcgccagacg
gcgggggaaattttagccgatggcaaaccggtttcgccttgcgccctgcgcggcatcaaa
attgccaccatcatgcagaacccgcgcagcgcctttaatccactgcacaccatgcacacc
cacgcgcgggaaacctgcctggcgttagggaaacccgccgatgacgctacgcttaccgct
gccatagaagcggtggggctggaaaacgccgcgcgcgtgctgaagctgtacccgttcgag
atgagcggcggcatgttgcagcgcatgatgattgcgatggcggtgctgtgtgaatcaccg
tttatcatcgccgatgaaccgaccaccgacctcgacgtggtagcacaggcgcgcatcctc
gatctgctggaaagcattatgcaaaaacaagcgccgggaatgctgctggtcacccatgat
atgggcgttgtggcgcgtctggcggatgacgtggcggtgatgtcacaaggtaaaattgtc
gaacagggcgatgtagaaacgctgtttaacgcccccaaacatacggtgacgcgcagcctg
gtttccgctcatctcgccctctacggtatggagctggcatcatga

DBGET integrated database retrieval system