KEGG   Escherichia coli B REL606: ECB_03334Help
Entry
ECB_03334         CDS       T00944                                 

Gene name
yhhI
Definition
(GenBank) predicted transposase
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3555066..3556202
Genome map
AA seq 378 aa AA seqDB search
MELKKLMEHISIIPDYRQTWKVEHKLSDILLLTICAVISGAEGWEDIEDFGETHLDFLKQ
YGDFENGIPVHDTIARVVSCISPAKFHECFINWMRDCHSSDDKDVIAIDGKTLRHSYDKS
RRRGAIHVISAFSTMHSLVIGQIKTDEKSNEITAIPELLNMLDIKGKIITTDAMGCQKDI
AEKIQKQGGDYLFAVKGTQGRLNKAFEEKFPLKELNNPEHDSYAISEKSHGREEIRLHIV
CDVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKEPEMTVRYYISSADLTAEKFATAIR
NHWHVENKLHWRLDVVMNEDDCKIRRGNAAELFSGIRHIAINILTNDKVFKAGLRRKMRK
AAMDRNYLASVLAGSGLS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggaacttaaaaaattgatggaacatatttctattatccccgattacagacaaacctgg
aaagtggaacataaattatcggatattctactgttgactatttgtgccgttatttctggt
gcagaaggttgggaagatatagaggattttggggaaacacatctcgattttttgaagcaa
tatggtgattttgaaaatggtattcctgttcacgataccattgccagagttgtatcctgt
atcagtcctgcaaaatttcacgagtgctttattaactggatgcgtgactgccattcttca
gatgataaagacgtcattgcaattgatggaaaaacgctccggcactcttatgacaagagt
cgccgcaggggagcgattcatgtcattagtgcgttctcaacaatgcacagtctggtcatc
ggacagatcaagacggatgagaaatctaatgagattacagctatcccagaacttcttaac
atgctggatattaaaggaaaaatcatcacaactgatgcgatgggttgccagaaagatatt
gcagagaagatacaaaaacagggaggtgattatttattcgcggtaaaaggaacccagggg
cggctaaataaagcctttgaggaaaaatttccgctgaaagaattaaataatccagagcat
gacagttacgcaatcagtgaaaagagtcacggcagagaagaaatccgtcttcatattgtt
tgcgatgtccctgatgaacttattgatttcacgtttgaatggaaagggctgaagaaatta
tgcgtggcagtctcctttcggtccataatagcagaacaaaagaaagagccagaaatgacg
gtcagatattatatcagttctgctgatttaaccgctgagaaattcgccacagcgatccga
aatcactggcacgtggagaataagctgcactggcgtctggacgtggtaatgaatgaagac
gactgcaaaataagaagaggaaatgcagcagaattattttcagggatacggcacattgct
attaatattttgacgaatgataaggtattcaaggcagggttaagacgtaagatgcgaaaa
gcagccatggacagaaactatctggcgtcagtccttgcggggagcgggctttcgtaa

DBGET integrated database retrieval system