KEGG   Escherichia coli B REL606: ECB_03335Help
Entry
ECB_03335         CDS       T00944                                 

Gene name
yhhJ
Definition
(GenBank) predicted transporter subunit: membrane component of ABC superfamily
  KO
K01992  
ABC-2 type transport system permease protein
Organism
ebr  Escherichia coli B REL606
Module
ABC-2 type transport system
Brite
Transporters [BR:ebr02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    ECB_03335 (yhhJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3556367..3557491)
Genome map
AA seq 374 aa AA seqDB search
MRHLRNIFNLGIKELRSLLGDKAMLTLIVFSFTVSVYSSATVTPGSLNLAPIAIADMDQS
QLSNRIVNSFYRPWFLPPEMITADEMDAGLDAGRYTFAINIPPNFQRDVLAGRQPDIQVN
VDATRMSQAFTGNGYIQNIINGEVNSFVARYRDNSEPLVSLETRMRFNPNLDPAWFGGVM
AIINNITMLAIVLTGSALIREREHGTVEHLLVMPITPFEIMMAKIWSMGLVVLVVSGLSL
VLMVKGVLGVPIEGSIPLFMLGVALSLFATTSIGIFMGTIARSMPQLGLLVILVLLPLQM
LSGGSTPRESMPQMVQDIMLTMPTTHFVSLAQAILYRGAGFEIVWPQFLTLMAIGGAFFT
IALLRFRKTIGTMA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgcgccatttacgcaatatttttaatctgggtatcaaagagttgcgcagtctgctcggt
gataaagcgatgctgacgctgattgtcttctcgtttacggtgtcggtgtattcgtcagcg
accgttacgccaggatcgttgaacctcgcgccgatcgccattgccgatatggatcaatcg
cagttatcgaaccggatcgttaacagcttctatcgtccgtggtttttgccaccggagatg
atcaccgccgatgagatggatgccggactggacgccggacgctataccttcgcgataaat
attccgcctaattttcagcgtgatgtcctcgccggacgccagccggatattcaggtgaac
gtcgatgccacgcgcatgagccaggcatttaccggcaatgggtatatccagaatattatc
aacggtgaagtgaacagctttgtcgcgcgctaccgtgataacagcgaaccgttggtatcg
ctggaaacccggatgcgctttaacccgaacctcgatcccgcgtggtttggcggggtgatg
gcgatcatcaacaacattaccatgctggcgattgtattgaccggatcggcgctgatccgc
gagcgtgaacacggcacggtggaacacttactggtgatgccgataacgccgtttgagatc
atgatggcgaagatctggtcgatggggctggtggtgctggtggtatcgggattatcgctg
gtgctgatggtgaaaggtgtactgggcgtaccgattgaaggctcgatcccgctgtttatg
ctgggcgtggcgctcagtctgtttgccaccacgtcaatcggcatttttatggggacgata
gcgcgttcaatgccgcaactggggctgctggtgattctggtgctgctgccgctgcaaatg
ctttccggtggttccacgccgcgcgaaagtatgccgcagatggtgcaggacattatgctg
accatgccgacgacacactttgttagcctcgcgcaggccatcctctaccggggtgccgga
ttcgaaatcgtctggccgcagtttctgacgctgatggcaattggcggcgcatttttcacc
attgcgctgctgcgattcaggaagacgattgggacaatggcgtaa

DBGET integrated database retrieval system