KEGG   Escherichia coli B REL606: ECB_03337Help
Entry
ECB_03337         CDS       T00944                                 

Gene name
yhiI
Definition
(GenBank) predicted HlyD family secretion protein
  KO
K01993  
HlyD family secretion protein
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3560223..3561290)
Genome map
AA seq 355 aa AA seqDB search
MDKSKRHLAWWVVGLLAVAAIVAWWLLRPAGVPEGFAVSNGRIEATEVDIASKIAGRIDT
ILVKEGQFVREGEVLAKMDTRVLQEQRLEAIAQIKEAQSAVAAAQALLEQRQSETRAAQS
LVNQRQAELDSVAKRHTRSRSLAQRGAISAQQLDDDRAAAESARAALESAKAQVSASKAA
IEAARTNIIQAQTRVEAAQATERRIAADIDDSELKAPRDGRVQYRVAEPGEVLAAGGRVL
NMVDLSDVYMTFFLPTEQAGTLKLGGEARLILDAAPDLRIPATISFVASVAQFTPKTVET
SDERLKLMFRVKARIPPELLQQHLEYVKTGLPGVAWVRVNEELPWPDDLVVRLPQ
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggataagagtaagcgccatctggcgtggtgggttgtcggcttactggcggtggcggct
atcgtggcgtggtggctgttgcgcccggcaggtgtgccggaaggctttgctgtcagtaat
gggcgcattgaagcgacggaagtggatattgccagcaaaattgccgggcgtatcgacacc
attctggtgaaagaaggccagtttgttcgcgaaggtgaagtgctggcgaagatggatact
cgcgtgttgcaggaacagcgactggaagccatcgcgcaaatcaaagaggcacaaagcgcc
gttgctgccgcgcaggctttgctggagcaacgacaaagcgaaactcgtgccgcacagtcg
ctggttaatcaacgccaggcagaactggactccgtagcaaaacgtcatacgcgttcccgt
tcactggcccaacgaggggctatttctgcgcaacagctggatgacgatcgcgccgccgct
gagagcgcccgagctgcgctggaatcggcgaaagctcaggtatcggcttctaaagcggct
atagaagcggcacgcaccaatatcattcaggcgcaaacccgcgtcgaagcggcacaagcc
actgaacggcgcattgccgcagatatcgatgacagcgaactgaaagccccgcgtgacgga
cgcgtgcagtatcgggttgccgagccaggcgaagtgctggcggcaggcggtcgggtgctg
aatatggtcgatctcagcgacgtctatatgactttcttcctgccaaccgaacaggcgggc
acgctgaaactgggcggtgaagcccggctgatcctcgatgccgcgccagatctgcgtatt
cctgcaaccatcagttttgtcgccagtgtcgcccagttcacgccaaaaaccgtcgaaacc
agcgatgaacggctgaaactgatgttccgcgtcaaagcgcgtatcccaccggaattactc
cagcagcatctggaatatgtcaaaaccggtttgccgggcgtagcgtgggtgcgggtgaat
gaagaacttccgtggcctgacgacctcgtggtgaggttgccgcaatga

DBGET integrated database retrieval system