KEGG   Escherichia coli B REL606: ECB_03342Help
Entry
ECB_03342         CDS       T00944                                 

Gene name
pitA
Definition
(GenBank) phosphate transporter, low-affinity
  KO
K16322  
low-affinity inorganic phosphate transporter
Organism
ebr  Escherichia coli B REL606
Brite
Transporters [BR:ebr02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ECB_03342 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
3568331..3569830
Genome map
AA seq 499 aa AA seqDB search
MLHLFAGLDLHTGLLLLLALAFVLFYEAINGFHDTANAVATVIYTRAMRSQLAVVMAAVF
NFLGVLLGGLSVAYAIVHMLPTDLLLNMGSSHGLAMVFSMLLAAIIWNLGTWYFGLPASS
SHTLIGAIIGIGLTNALMTGTSVVDALNIPKVLSIFGSLIVSPIVGLVFAGGLIFLLRRY
WSGTKKRARIHLTPAEREKKDGKKKPPFWTRIALILSAIGVAFSHGANDGQKGIGLVMLV
LIGVAPAGFVVNMNATGYEITRTRDAINNVEAYFEQHPALLKQATGADQLVPAPEAGATQ
PAEFHCHPSNTINALNRLKGMLTTDVESYDKLSLDQRSQMRRIMLCVSDTIDKVVKMPGV
SADDQRLLKKLKSDMLSTIEYAPVWIIMAVALALGIGTMIGWRRVATTIGEKIGKKGMTY
AQGMSAQMTAAVSIGLASYTGMPVSTTHVLSSSVAGTMVVDGGGLQRKTVTSILMAWVFT
LPAAVLLSGGLYWLSLQFL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgctacatttgtttgctggcctggatttgcataccgggctgttattattgcttgcactg
gcttttgtgctgttctacgaagccatcaatggtttccatgacacagccaacgccgtggca
accgttatctatacccgcgcgatgcgttctcagctcgccgtggttatggcggcggtgttc
aactttttgggtgttttgctgggtggtctgagtgttgcctatgccattgtgcatatgctg
ccgacggatctgctgcttaatatgggatcgtctcatggccttgccatggtgttctctatg
ttgctggcggcgattatctggaacctgggtacctggtactttggtttacctgcatccagc
tctcatacgctgattggcgcgatcatcgggattggtttaaccaatgcgttgatgaccggg
acgtcagtggtggatgcactcaatatcccgaaagtattaagtattttcggttctctgatc
gtttcccctattgtcggcctggtgtttgctggcggtctgattttcttgctgcgtcgctac
tggagcggcaccaagaaacgcgcccgtatccacctgaccccagcggagcgtgaaaagaaa
gacggcaagaaaaagccgccattctggacgcgtatcgcgctgatcctttccgctatcggc
gtggcgttttcgcacggcgcgaacgatggtcagaaaggcattggtctggttatgttggta
ttgattggcgtcgcgccagcaggcttcgtggtgaacatgaatgccactggctacgaaatc
acccgtacccgtgatgccatcaacaacgtcgaagcttactttgagcagcatcctgcgctg
ctcaaacaggctaccggtgctgatcagttagtaccggctccggaagctggcgcaacgcaa
cctgcggagttccactgccatccgtcgaataccattaacgcgctcaaccgcctgaaaggt
atgttgaccaccgatgtggaaagctacgacaagctgtcgcttgatcaacgtagccagatg
cgccgcattatgctgtgcgtttctgacactatcgacaaagtggtgaagatgcctggcgtg
agtgctgacgatcagcgcctgttgaagaaactgaagtccgacatgcttagcaccatcgag
tatgcaccggtgtggatcatcatggcggtcgcgctggcgttaggtatcggtacgatgatt
ggctggcgccgtgtggcaacgactatcggtgagaaaatcggtaagaaaggcatgacctac
gctcaggggatgtctgcccagatgacggcggcagtgtctatcggcctggcgagttatacc
gggatgccggtttccactactcacgtactctcctcttctgtcgcggggacgatggtggta
gatggtggcggcttacagcgtaaaaccgtgaccagcattctgatggcctgggtgtttacc
cttccggctgcggtactgctttccggcgggctgtactggctctccttgcagttcctgtaa

DBGET integrated database retrieval system