KEGG   Escherichia coli B REL606: ECB_03349Help
Entry
ECB_03349         CDS       T00944                                 

Gene name
gor
Definition
(GenBank) glutathione reductase
  KO
K00383  
glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
ebr  Escherichia coli B REL606
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ECB_03349 (gor)
Enzymes [BR:ebr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     ECB_03349 (gor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
3576989..3578341
Genome map
AA seq 450 aa AA seqDB search
MTKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIR
EAIHMYGPDYGFDTTINKFNWETLIASRTAYIDRIHTSYENVLGKNNVDVIKGFARFVDA
KTLEVNGETITADHILIATGGRPSHPDIPGVEYGIDSDGFFALPALPERVAVVGAGYIAV
ELAGVINGLGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNADG
SLTLELEDGRSETVDCLIWAIGREPANDNINLEAAGVKTNEKGYIVVDKYQNTNIEGIYA
VGDNTGAVELTPVAVAAGRRLSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQAR
EQYGDDQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGSEEKIVGIHGIGFGMDEMLQGFA
VALKMGATKKDFDNTVAIHPTAAEEFVTMR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacactatgattacatcgccatcggcggcggcagcggcggtatcgcctccatc
aaccgcgcggctatgtacggccagaaatgtgcgctgattgaagccaaagagctgggcggc
acctgcgtaaatgttggctgtgtgccgaaaaaagtgatgtggcacgcggcgcaaatccgt
gaagcgatccatatgtacggcccggattatggttttgataccactatcaataaattcaac
tgggaaacgttgatcgccagccgtaccgcctatatcgaccgtattcatacttcctatgaa
aacgtgctcggtaaaaataacgttgatgtaatcaaaggctttgcccgcttcgttgatgcc
aaaacgctggaggtaaacggcgaaaccatcacggccgatcatattctgatcgccacaggc
ggtcgtccgagccacccggatattccgggcgtggaatacggtattgattctgatggcttc
ttcgcccttcctgctttgccagagcgcgtggcggttgttggagcgggttacatcgccgtt
gagctggcgggcgtgattaacggcctcggcgcgaaaacgcatctgtttgtgcgtaaacat
gcgccgctgcgcagcttcgacccgatgatttccgaaacgctggtcgaagtgatgaacgcc
gaaggcccgcagctgcacaccaacgccatcccgaaagcggtagtgaaaaatgccgatggt
agcctgacgctggagctggaagatggtcgcagtgaaacggtggattgcctgatttgggcg
attggtcgcgagcctgccaatgacaacatcaacctggaagccgctggcgttaaaactaac
gaaaaaggctatatcgtcgtcgataaatatcaaaacaccaatattgaaggtatttacgcg
gtgggcgataacacgggtgcagtggagctgacaccggtggcagttgcagcgggtcgccgt
ctctctgaacgcctgtttaataacaagccggatgagcatctggattacagcaacattccg
accgtggtcttcagccatccgccgattggtactgttggtttaacggaaccgcaggcgcgc
gagcagtatggcgacgatcaggtgaaagtgtataaatcctctttcaccgcgatgtatacc
gccgtcaccactcaccgccagccgtgccgcatgaagctggtgtgcgttggatcggaagag
aagattgtcggtattcacggcattggctttggtatggacgaaatgttgcagggcttcgcg
gtggcgctgaagatgggggcaaccaaaaaagacttcgacaataccgtcgccattcaccca
acggcggcagaagagttcgtgacaatgcgttaa

DBGET integrated database retrieval system