KEGG   Escherichia coli B REL606: ECB_03351Help
Entry
ECB_03351         CDS       T00944                                 

Gene name
arsB
Definition
(GenBank) arsenite/antimonite transporter
  KO
K03893  
arsenical pump membrane protein
Organism
ebr  Escherichia coli B REL606
Brite
Transporters [BR:ebr02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ECB_03351 (arsB)
  Others
   ECB_03351 (arsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3579625..3580914
Genome map
AA seq 429 aa AA seqDB search
MLLAGAIFVLTIVLVIWQPKGLGIGWSATLGAVLALVTGVVHPGDIPVVWNIVWNATAAF
IAVIIISLLLDESGFFEWAALHVSRWGNGRGRLLFTWIVLLGAAVAALFANDGAALILTP
IVIAMLLALGFSKGTTLAFVMAAGFIADTASLPLIVSNLVNIVSADFFGLGFREYASVMV
PVDIAAIVATLVMLHLYFRKDIPQNYDMALLKSPAEAIKDPATFKTGWVVLLLLLVGFFV
LEPLGIPVSAIAAVGALILFVVAKRGHAINTGKVLRGAPWQIVIFSLGMYLVVYGLRNAG
LTEYLSGVLNVLADNGLWAATLGTGFLTAFLSSIMNNMPTVLVGALSIDGSTASGVIKEA
MVYANVIGCDLGPKITPIGSLATLLWLHVLSQKNMTISWGYYFRTGIIMTLPVLFVTLAA
LALRLSFTL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgttactggcaggcgctatctttgtcctgaccatcgtattggttatctggcagccgaaa
ggtttaggcatcggctggagtgcaacgctcggcgcagtactggcgttagttacgggcgtg
gtccatccgggtgatattccggtggtgtggaatatcgtctggaacgcgacggctgcgttt
atcgccgtcattatcatcagcctgctgctggatgagtccggcttttttgaatgggcggcg
ctgcacgtctcacgctggggtaatggtcgtggtcgcttgctgtttacctggattgtcctg
ctcggtgctgccgttgccgccctgtttgccaatgatggcgcggcgcttattttgacaccg
attgtcatcgccatgctgctggctttagggttcagtaaaggcactacgctggcgttcgtg
atggcggccggattcattgccgataccgccagcctgccgcttattgtctccaacctggtg
aatatcgtttccgctgatttctttggcctcggctttcgcgaatacgcctcggtgatggtg
ccggtggatatcgccgcgattgttgccacgctggtgatgttacatctctattttcgcaaa
gatattccgcagaactacgatatggcgctgctgaaatctcccgcagaagcgatcaaagat
cctgctacgttcaaaactggctgggttgttttactgcttctgctggtgggatttttcgtc
ctggaaccgctcggcattccggtgagcgccattgcagctgtgggcgcgctgatattattt
gtcgtcgctaaacgcggtcatgcgattaatacgggtaaagtcctgcgcggtgccccctgg
cagattgtcatcttctcgctcggcatgtatctggtggtttatggcctgcgcaatgccgga
ttaacggaatatctttctggcgtactcaacgtgctggcggataacggcctgtgggccgcg
acgctcggcaccggattcctcaccgccttcctctcttctattatgaacaatatgccgacg
gtactggttggcgcgttgtccattgatggcagcacggcatctggcgttatcaaagaagcg
atggtttatgccaatgtgattggctgcgatttgggaccgaaaattaccccaattggtagc
ctggctacgctactctggctgcacgtactttcgcagaagaatatgactatcagctgggga
tattacttccgtacagggattatcatgaccctgcctgtgctgtttgtgacgctggctgcg
ctggcgctacgtctctctttcactttgtaa

DBGET integrated database retrieval system