KEGG   Escherichia coli B REL606: ECB_03353Help
Entry
ECB_03353         CDS       T00944                                 

Gene name
yhiS
Definition
(GenBank) hypothetical protein
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
3581981..3583204
Genome map
AA seq 407 aa AA seqDB search
MSIDFTPGIINTYHGDIYNCTTNTDNAKTPDTPKWPCDNWEEQQPINSTFSGEGYISDQY
DLAQHQLQQINACHTNTTYTNADYSKVVAQLVSLITNIETISSTQLTQQTQSILNQINNI
RYEKNKSAECRIIVIANPKPDKAIITKISVEEGIPITFSVQTMFSDTNFIAEQRADLPTN
IKDIQSLYQKMTKLYIEHSENKNRMKVFAGTNFIDFNMTGQNLSGFVLTLSRFYFEDLLN
INFTDANLGDTIFLHKEHPTPKLYKDGQYLDKQIEGLFSTLLTINDNLLRAKAEIASTII
KFLEARITNLSYNDILKYQQEFQKQCYKQVKAFTTLSRYNKIQTWAEMSEYQFEVFQYET
LNPKKMSHTPYLKRPLPNEKDINYGVEIEIPSGKRIRLSNHYQNIIP
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattgactttaccccaggtataataaatacatatcacggcgatatttataactgc
acaacaaataccgataatgctaaaacgccagacacaccgaagtggccttgcgataattgg
gaagaacaacaacccattaattccacattctctggagaaggatatatctctgatcaatat
gatttagcgcaacaccaacttcaacaaattaatgcgtgccacacgaacactacatataca
aatgcagactactcaaaagttgtggctcaacttgtaagtcttattactaacattgaaacg
ataagttcgacacaacttacgcaacagacacaatcaatacttaatcagattaataacatt
agatatgaaaaaaacaaaagtgctgaatgtcgaatcattgttatcgctaatcctaaaccc
gacaaggcaatcataactaaaattagcgtagaagagggaatacccataacattcagtgtc
caaaccatgttttcagatactaattttattgctgaacaacgagctgacttaccaactaat
ataaaagatattcaaagcctgtatcaaaaaatgacgaagttatatattgagcacagtgaa
aataaaaacaggatgaaagtctttgccggaaccaactttattgatttcaatatgacagga
cagaacctgtccgggttcgttctaaccttgtcaaggttttatttcgaagatctacttaat
ataaatttcactgacgcaaatttaggtgacactatttttttacataaagaacaccctacc
cccaaattatataaagatggacaatatcttgacaaacaaatcgaaggtttattttcaaca
ttattaaccattaatgacaaccttttacgagcaaaagcggaaattgcttcgacaataatt
aaatttttagaggccaggataaccaatctttcatacaatgacatattaaaatatcagcaa
gaattccaaaaacaatgttataagcaagttaaagcctttacgacactctcccgatacaat
aaaattcaaacatgggcagaaatgtctgaatatcaattcgaagtatttcaatacgagacg
cttaacccaaaaaaaatgtcacacacgccttatttaaagaggccactgcctaatgaaaaa
gatataaattatggggtggaaatagaaataccatctggtaaaagaattcgcttatcaaat
cattaccagaatataataccataa

DBGET integrated database retrieval system