KEGG   Escherichia coli B REL606: ECB_03360Help
Entry
ECB_03360         CDS       T00944                                 

Gene name
yhiE
Definition
(GenBank) DNA-binding transcriptional activator
  KO
K21907  
LuxR family transcriptional regulator, glutamate-dependent acid resistance regulator
Organism
ebr  Escherichia coli B REL606
Brite
Transcription factors [BR:ebr03000]
 Prokaryotic Type
  Helix-turn-helix
   LuxR family
    ECB_03360 (yhiE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3587857..3588384
Genome map
AA seq 175 aa AA seqDB search
MIFLMTKDSFLLQGFWQLKDNHEMIKINSLSEIKKVGNKPFKVIIDTYHNHILDEEAIKF
LEKLDAERIIVLAPYHISKLKAKAPIYFVSRKESIKNLLEITYGKHLPHKNSQLCFSHNQ
FKIMQLILKNKNESNITSTLNISQQTLKIQKFNIMYKLKLRRMSDIVTLGITSYF
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgatttttctcatgacgaaagattcttttcttttacagggcttttggcagttgaaagat
aatcacgaaatgataaaaatcaattccctgtcagagatcaaaaaagtaggcaataaaccc
ttcaaggttatcattgatacctatcacaatcatatccttgatgaagaagcgattaaattt
ctggagaaattagatgccgagagaattattgttttggcaccttatcacatcagtaaacta
aaagctaaagcgcctatttattttgttagccgcaaagaaagtatcaaaaatcttcttgag
attacttatggtaaacacttgccccataagaattcacaattatgtttttcacataatcag
ttcaaaattatgcaactgattctgaaaaataaaaatgaaagcaatatcacgtcgacgctc
aatatttcgcaacaaacattaaagattcagaaattcaacattatgtacaagctgaaacta
agacgtatgagcgacatcgtcaccctgggtatcacatcttatttttag

DBGET integrated database retrieval system