KEGG   Escherichia coli B REL606: ECB_03364Help
Entry
ECB_03364         CDS       T00944                                 

Gene name
gadX
Definition
(GenBank) DNA-binding transcriptional dual regulator
  KO
K21905  
AraC family transcriptional regulator, glutamate-dependent acid resistance regulator
Organism
ebr  Escherichia coli B REL606
Brite
Transcription factors [BR:ebr03000]
 Prokaryotic Type
  Helix-turn-helix
   AraC family
    ECB_03364 (gadX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(3594477..3595301)
Genome map
AA seq 274 aa AA seqDB search
MQSLHGNCLIAYARHKYILTMVNGEYRYFNGGDLVFADASQIRVDKCVENFVFVSRDTLS
LFLPMLKEEALNLHAHKKVSSLLVHHCSRDIPVFQEVAQLSQNKNLRYAEMLRKRALIFA
LLSVFLEDEHFIPLLLNVLQPNMRTRVCTVINNNIAHEWTLARIASELLMSPSLLKKKLR
EEETSYSQLLTECRMQRALQLIVIHGFSIKRVAVSCGYHSVSYFIYVFRNYYGMTPTEYQ
ERSAQRLSNRDSAASIVAQGNFYGTDRSAEGIRL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcactacatgggaattgtctaattgcgtatgcaagacataaatatattctcacc
atggttaatggtgaatatcgctattttaatggcggtgacctggtttttgcggatgcaagc
caaattcgagtagataagtgtgttgaaaattttgtattcgtgtcaagggacacgctttca
ttatttctcccgatgctcaaggaggaggcattaaatcttcatgcacataaaaaagtttct
tcattactcgttcatcactgtagtagagatattcctgtttttcaggaagttgcgcaacta
tcgcagaataagaatcttcgctatgcagaaatgctacgtaaaagagcattaatctttgcg
ttgttatctgtttttcttgaggatgagcactttataccgctgcttctgaacgttttacaa
ccgaacatgcgaacacgagtttgtacggttatcaataataatatcgcccatgagtggaca
ctagcccgaatcgccagcgagctgttgatgagtccaagtctgttaaagaaaaaattgcgc
gaagaagagacatcatattcacagttgcttactgagtgtagaatgcaacgtgctttgcaa
cttattgttatacatggtttttcaattaagcgagttgcagtatcctgtggatatcacagc
gtgtcgtatttcatttacgtctttcgaaattattatgggatgacgcccacagagtatcag
gagcgatcggcgcagagattgtcgaaccgtgactcggcggcaagtattgttgcgcaaggg
aatttttacggcactgaccgttctgcggaaggaataagattatag

DBGET integrated database retrieval system