KEGG   Escherichia coli B REL606: ECB_03366Help
Entry
ECB_03366         CDS       T00944                                 

Gene name
yhjA
Definition
putative cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ebr  Escherichia coli B REL606
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3597282..3598679)
Genome map
AA seq 465 aa AA seqDB search
MKMVSRITAIGLAGVAICYLGLSGYVWYHDNKRSKQADVQASAVSENNKVLGFLREKGCD
YCHTPSAELPAYYYIPGAKQLMDYDIKLGYKSFNLEAVRAALLADKPVSQSDLNKIEWVM
QYETMPPTRYTALHWAGKVSDEERAEILAWIAKQRAEYYASNDTAPEHRNEPVQPIPQKL
PTDAQKVALGFALYHDPRLSADSTISCAHCHALNAGGVDGRKTSIGVGGAVGPINAPTVF
NSVFNVEQFWDGRAATLQDQAGGPPLNPIEMASKSWDEIIAKLEKDPQLKTQFLEVYPQG
FSGENITDAIAEFEKTLITPDSPFDKWLRGDENALTAQQKKGYQLFKDNKCATCHGGIIL
GGRSFEPLGLKKDFNFGEITAADIGRMNVTKEERDKLRQKVPGLRNVALTAPYFHRGDVP
TLDGAVKLMLRYQVGKELPQEDVDDIVAFLHSLNGVYTPYMQDKQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggtctcacgtattaccgcgatcggcctggctggcgtcgcgatttgctattta
gggttatctggttatgtgtggtaccacgataataaacgcagtaaacaggccgatgttcag
gcatctgctgtcagtgaaaataataaggttttaggctttctccgcgaaaaaggatgcgac
tattgccacacgccttcggcagaattacccgcctattattatattcctggcgcgaaacag
ttgatggattacgacattaagcttggatataaatcttttaaccttgaggccgtgcgtgcg
gcactgctggctgataaacccgtttcgcaaagcgatttgaataagattgaatgggtgatg
cagtatgaaactatgccaccaacgcgttataccgcgctacactgggcgggtaaggtgagt
gatgaagagcgggcggaaatactggcctggattgcaaaacagcgcgcggaatattacgcc
agcaatgatactgctccggaacatcgcaatgaaccggtgcagcccatcccgcaaaaactg
cctaccgatgcgcaaaaagtggcgttgggttttgcgctgtatcacgatccccgtttatcg
gctgatagcaccatttcatgcgctcattgccatgcgttgaatgcggggggcgtcgatggc
agaaaaacatcgattggtgttggtggcgcagttgggccgattaacgcgccgacggtattt
aactcagtatttaacgttgagcagttctgggatggtcgtgcggcaacattgcaggatcag
gctggtggaccgccgttgaacccgattgaaatggcgtcgaaatcctgggacgaaattatt
gctaagctggaaaaagatccgcagcttaaaacgcagttcctcgaagtctatccgcaaggt
ttcagtggcgaaaatattactgatgccattgctgaatttgagaaaacattaattacgccg
gattccccatttgataaatggttgcgcggagatgaaaatgcgctgacggcgcaacagaaa
aaaggctatcaattatttaaagataataaatgtgcaacttgtcatggtggtattattctc
ggcggacgttcctttgaaccgttggggctgaaaaaagactttaactttggggaaattacg
gcggcggatattggtcgtatgaatgtgactaaagaagagcgtgataaattgcgtcagaaa
gtacccggtttacgtaacgttgctttaacggcaccgtacttccatcgcggtgacgtgccg
acgctggacggggcggtgaaactgatgctgcgctatcaggtaggcaaagagctgccgcag
gaggatgtggatgatatcgtagctttcctgcacagtctgaacggggtgtacacgccgtat
atgcaggataaacaataa

DBGET integrated database retrieval system