KEGG   Escherichia coli B REL606: ECB_03376Help
Entry
ECB_03376         CDS       T00944                                 

Gene name
dctA
Definition
(GenBank) C4-dicarboxylate transport protein
  KO
K11103  
aerobic C4-dicarboxylate transport protein
Organism
ebr  Escherichia coli B REL606
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ECB_03376 (dctA)
Transporters [BR:ebr02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ECB_03376 (dctA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3611653..3612939)
Genome map
AA seq 428 aa AA seqDB search
MKTSLFKSLYFQVLTAIAIGILLGHFYPEIGEQMKPLGDGFVKLIKMIIAPVIFCTVVTG
IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAKAVAVY
ADQAKDQGIVAFIMDVIPASVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES
FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGS
IAKATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF
NLDGTSIYLTMAAVFIAQATNSQMDIVHQITLLIVFLLSSKGAAGVTGSGFIVLAATLSA
VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWVKELDHKKLDDVLNNRAPD
GKTHELSS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctctctgtttaaaagcctttactttcaggtcctgacagcgatagccattggt
attctccttggccatttctatcctgaaataggcgagcaaatgaaaccgcttggcgacggc
ttcgttaagctcattaagatgatcatcgctcctgtcatcttttgtaccgtcgtaacgggc
attgcgggcatggaaagcatgaaggcggtcggtcgtaccggcgcagtcgcactgctttac
tttgaaattgtcagtaccatcgcgctgattattggtcttatcatcgttaacgtcgtgcag
cctggtgccggaatgaacgtcgatccggcaacgcttgatgcgaaagcggtagcggtttac
gccgatcaggcgaaagaccagggcattgtcgccttcattatggatgtcatcccggcgagc
gtcattggcgcatttgccagcggtaacattctgcaggtgctgctgtttgccgtactgttt
ggttttgcgctccaccgtctgggcagcaaaggccaactgatttttaacgtcatcgaaagt
ttctcgcaggtcatcttcggcatcatcaatatgatcatgcgtctggcacctattggtgcg
ttcggggcaatggcgtttaccatcggtaaatacggcgtcggcacactggtgcaactgggg
cagctgattatctgtttctacattacctgtatcctgtttgtggtgctggtattgggttca
atcgctaaagcgactggtttcagtatcttcaaatttatccgctacatccgtgaagaactg
ctgattgtactggggacttcatcttccgagtcggcgctgccgcgtatgctcgacaagatg
gagaaactcggctgccgtaaatcggtggtggggctggtcatcccgacaggctactcgttt
aaccttgatggcacatcgatatacctgacaatggcggcggtgtttatcgcccaggccact
aacagtcagatggatatcgtccaccaaatcacgctgttaatcgtgtttctgctttcttct
aaaggggcggcaggggtaacgggtagtggctttatcgtgctggcggcgacgctctctgcg
gtgggccatttgccggtagcgggtctggcgctgatcctcggtatcgaccgctttatgtca
gaagctcgtgcgctgactaacctggtcggtaacggcgtagcgaccattgtcgttgctaag
tgggtgaaagaactggaccacaaaaaactggacgatgtgctgaataatcgtgcgccggat
ggcaaaacgcacgaattatcctcttaa

DBGET integrated database retrieval system