KEGG   Escherichia coli B REL606: ECB_03377Help
Entry
ECB_03377         CDS       T00944                                 

Gene name
yhjK
Definition
(GenBank) predicted diguanylate cyclase
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EAL GAPES3 GGDEF HAMP CHASE8 DUF588
Motif
Other DBs
NCBI-ProteinID: ACT41023
Position
complement(3613122..3615071)
Genome map
AA seq 649 aa AA seqDB search
MVAAVVLVFVFIFCTVLLFHLVQQNRYNTATQLESIARSVREPLSSAILKGDIPEAEAIL
ASIKPAGVVSRADVVLPNQFQALRKSFIPERPVPVMVTRLFELPVQISLGVYSLERPANP
QPIAYLVLQADSFRMYKFVMSTLSTLVTIYLLLSLILTVAISWCINRLILHPLRNIAREL
NAIPAKELVGHQLALPRLHQDDEIGMLVRSYNLNQQLLQRHYEEQNENAMRFPVSDLPNK
ALLMEMLEQVVARKQTTALMIITCETLRDTAGVLKEAQREILLLTLVEKLKSVLSPRMIL
AQISGYDFAVIANGVQEPWHAITLGQQVLTIMSERLPIERIQLRPHCSIGVAMFYGDLTA
EQLYSRAISAAFTARHKGKNQIQFFDPQQMEAAQKRLTEESDILNALENHQFAIWLQPQV
EMTSGKLVSAEVLLRIQQPDGSWDLPDGLIDRIECCGLMVTVGHWVLEESCRLLAAWQER
GIMLPLSVNLSALQLMHPNMVADMLELLTRYRIQPGTLILEVTESRRIDDPHAAVAILRP
LRNAGVRVALDDFGMGYAGLRQLQHMKSLPIDVLKIDKMFVEGLPGDSSMIAAIIMLAQS
LNLQMIAEGVETEAQRDWLAKAGVGIAQGFLFARPLPIEIFEESYLEEK
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggtggcagccgttgtcctggtgttcgtttttattttttgcaccgttttgctgttccat
ctggtccagcagaatcgctataacacggctacgcaactggaaagcattgctcgctctgtc
cgcgaacccttatcttcagctattttgaaaggcgatattcccgaagcggaagctattctt
gccagcattaaaccggcaggcgtggtcagccgtgccgatgtagtgctgcctaaccagttc
caggcgctgcgtaaaagttttattccagagcgcccggtgccggtaatggttactcgcctg
tttgagctaccggttcaaatctcgctgggcgtttactcgctcgaacgtccggcaaacccg
cagccaattgcctatctggtactacaggcggattccttccgtatgtataagttcgtgatg
agcaccctctcaacgttagtgaccatttacttacttttgtcgcttatcctgaccgtcgcc
atcagctggtgcattaaccgcctgattttgcatccgttacgcaatattgctcgcgaactt
aacgccatcccagccaaggagcttgttggtcaccaactggcattaccgcgtctgcatcag
gacgatgaaatcggtatgttggtgcgcagttacaacctcaaccagcaattgctgcagcgc
cattatgaagaacagaacgaaaatgcgatgcgcttcccggtgtcggatttgccgaacaaa
gccttgctgatggagatgctggagcaggttgtcgcgcgtaaacaaaccaccgcgctgatg
atcatcacctgtgaaaccctgcgtgatactgcgggcgtgctgaaagaggcgcaacgagaa
attctgctgctgacgctggtggaaaaactcaaatcggtactgtcgccacgtatgatcctc
gcgcagattagcggttatgactttgctgtcattgccaacggtgtacaggaaccgtggcac
gcaatcaccttaggtcagcaagtgctcactatcatgagcgagcgcctgccgattgaacgt
attcaactccgtccgcactgtagcattggcgtggcgatgttctacggcgatctcaccgcc
gaacagctttacagtcgcgctatttctgcggcatttaccgctcgccataaaggcaagaat
cagattcagttctttgatccgcagcagatggaagccgcccagaagcggttgacggaagag
agcgatatccttaatgcactggaaaatcatcagtttgctatttggttacagccacaggtc
gagatgaccagcggtaaactggtcagtgcggaagtgttactgcgtatccagcaaccggat
ggcagttgggacctgccggatggcttaatcgatcgcattgagtgctgtgggctgatggtt
accgtcggtcactgggtgctggaagagtcctgtcgattgcttgcagcctggcaagagcgc
ggcattatgctgcccttgtcggtaaacctctctgcgctgcaactgatgcacccgaatatg
gtggcggatatgctggaactgttaacccgctatcgcattcagccgggaacactgattctg
gaagtgacagaaagccgacgtattgacgaccctcatgctgcggtggcaatcctccgtccg
ctgcgcaatgccggagttcgggtggcgctggatgatttcggcatgggctacgcagggctg
cgtcagctgcagcatatgaaatcgttgccaatcgacgtactgaaaatcgacaaaatgttt
gttgaaggcttgccgggagatagcagcatgattgctgcaattatcatgctggcgcagagc
ctgaacttacaaatgattgccgaaggcgtggagactgaagcacaacgcgactggctggca
aaagcgggcgttggtattgcccagggcttcctttttgctcgcccactccctattgaaatc
ttcgaagagagttacctggaagaaaagtag

DBGET integrated database retrieval system