KEGG   Escherichia coli B REL606: ECB_03385Help
Entry
ECB_03385         CDS       T00944                                 

Gene name
yhjT
Definition
(GenBank) hypothetical protein
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3627521..3627709
Genome map
AA seq 62 aa AA seqDB search
MTISDIIEIIVVCALIFFPLGYLARHSLRRIRDTLRLFFAKPRYVKPAGTLRRTEKARAT
KK
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcagcgatatcattgaaattattgtcgtttgcgcactgatatttttcccgctg
ggctatctggcgcggcactctttgcgacgcattcgcgacaccttacgtttgttctttgct
aaacctcgttatgttaaaccggccgggacgttacgccgcacggaaaaagccagggcaacc
aaaaaatga

DBGET integrated database retrieval system