KEGG   Escherichia coli B REL606: ECB_03388Help
Entry
ECB_03388         CDS       T00944                                 

Gene name
ldrE
Definition
(GenBank) toxic polypeptide, small
  KO
K18862  
small toxic polypeptide LdrA/B/C/D
Organism
ebr  Escherichia coli B REL606
Brite
Prokaryotic defense system [BR:ebr02048]
 Toxin-antitoxin system (TA system)
  Type I TA system
   Ldr-Rdl
    ECB_03388 (ldrE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3629955..3630062)
Genome map
AA seq 35 aa AA seqDB search
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
NT seq 108 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgcagaactgggcatggccttctggcatgatttagcggctccggtcattgct
ggtattcttgccagtatgatcgtgaactggctgaacaagcggaagtaa

DBGET integrated database retrieval system