KEGG   Escherichia coli B REL606: ECB_03704Help
Entry
ECB_03704         CDS       T00944                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ebr  Escherichia coli B REL606
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECB_03704 (pldB)
Enzymes [BR:ebr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ECB_03704 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3973597..3974619
Genome map
AA seq 340 aa AA seqDB search
MFQQQKDWETRENAFAAFTMGPLTDFWRQRDEAEFTGVDDIPVRFVRFRAQHHDRVVVIC
PGRIESYVKYAELAYDLFHLGFDVLIIDHRGQGRSGRLLADPHLGHVNRFNDYVDDLAAF
WQQEVQPGPWRKRYILAHSMGGAISTLFLQRHPGVCDAIALTAPMFGIVIRMPSFMARQI
LNWAEAHPRFRDGYAIGTGRWRALPFAINVLTHSRQRYRRNLRFYADDPTIRVGGPTYHW
VRESILAGEQVLAGAGDDATPTLLLQAEEERVVDNRMHDRFCELRTAAGHPVEGGRPLVI
KGAYHEILFEKDAMRSVALHAIVDFFNRHNSPSGNRSTEV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagcagcaaaaagactgggaaacaagagaaaacgcgtttgctgcttttaccatg
ggaccgctgactgatttctggcgtcagcgtgatgaagcagaatttactggtgtggatgac
attccggtgcgctttgtccgttttcgcgcacagcaccatgaccgggtggtagtcatctgc
ccggggcgtattgagagctacgtaaaatatgcggaactggcctacgacctgttccatttg
gggtttgatgtcttaatcatcgaccatcgcgggcagggacgttccggtcgcctgttagcc
gatccgcatctcgggcatgttaatcgctttaatgattatgttgatgatctggcggcattc
tggcaacaggaggttcagcccggtccgtggcgtaaacgctatatactggcacattcaatg
ggcggtgcgatctccacattatttctgcaacgccatccaggtgtatgtgacgccattgcg
ctaactgcgccaatgtttgggatcgtgattcgtatgccgtcatttatggcacggcagatc
ctcaactgggccgaagcgcatccacgtttccgtgatggctatgcaataggcaccgggcgc
tggcgcgcgttgccgtttgctatcaacgtactgacccacagcagacagcgatatcgacgt
aacttacgcttctatgctgatgatccaacgattcgcgtcggtgggccgacctaccattgg
gtacgcgaaagtattctggctggcgaacaggtgttagccggtgcgggtgatgacgccacg
ccaacgcttctcttacaagctgaagaggaacgcgtggtggataaccgcatgcatgaccgt
ttttgtgaactccgcaccgctgcgggccatcctgtcgaaggaggacggccgttggtaatt
aaaggtgcgtaccatgagatcctttttgaaaaggacgcaatgcgctcagtcgcgctccac
gccatcgttgattttttcaacaggcataactcacccagcggaaaccgctctacagaggtt
taa

DBGET integrated database retrieval system