KEGG   Escherichia coli B REL606: ECB_03826Help
Entry
ECB_03826         CDS       T00944                                 

Gene name
metL
Definition
bifunctional aspartate kinase II/homoserine dehydrogenase II (EC:2.7.2.4 1.1.1.3)
Orthology
K12525  
bifunctional aspartokinase / homoserine dehydrogenase 2 [EC:2.7.2.4 1.1.1.3]
Organism
ebr  Escherichia coli B REL606
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Methionine biosynthesis, apartate => homoserine => methionine
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ebr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ebr00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ebr00270]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ebr00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4109942..4112374
Genome map
AA seq 810 aa AA seqDB search
MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMMVVSAAGCTTNQLINW
LKLSQTDRLSAHQVQQTLRRYQCDLISGLLPAEEADSLISAFVSDLERLAALLDSGINDA
VYAEVVGHGEVWSARLMSAVLNQQGLPAAWLDAREFLRAERAAQPQVDEGLSYPLLQQLL
VQHPGKRLVVTGFISRNNAGETVLLGRNGSDYSATQIGALAGVSRVTIWSDVAGVYSADP
RKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSEIDLQLRCSYTPDQGSTRIER
VLASGTGARIVTSHDDVCLIEFQVPASQDFKLAHKEIDQILKRAQVRPLAVGVHNDRQLL
QFCYTSEVADSALKILDEAGLPGELRLRQGLALVAMVGAGVTRNPLHCHRFWQQLKGQPV
EFTWQSDDGISLVAVLRTGPTESLIQGLHQSVFRAEKRIGLVLFGKGNIGSRWLELFARE
QSTLSARTGFEFVLAGVVDSRRSLLSYDGLDASRALAFFNDEAVEQDEESLFLWMRAHPY
DDLVVLDVTASQQLADQYLDFASHGFHVISANKLAGASDSNKYRQIHDAFEKTGRHWLYN
ATVGAGLPINHTVRDLIDSGDTILSISGIFSGTLSWLFLQFDGSVPFTELVDQAWQQGLT
EPDPRDDLSGKDVMRKLVILAREAGYNIEPDQVRVESLVPAHCEGGSIDHFFENGDELNE
QMVQRLEAAREMGLVLRYVARFDANGKARVGVEAVREDHPLASLLPCDNVFAIESRWYRD
NPLVIRVPGAGRDVTAGAIQSDINRLAQLL
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgattgcgcaggcaggggcgaaaggtcgtcagctgcataaatttggtggcagt
agtctggctgatgtgaagtgttatttgcgtgtcgcgggcattatggcggagtactctcag
cctgacgatatgatggtggtttccgccgccggttgcaccactaaccagttgattaactgg
ttgaaactaagccagaccgatcgtctctctgcgcatcaggttcaacaaacgctgcgtcgc
tatcagtgcgatctgattagcggtctgctacccgctgaagaagccgatagcctcattagc
gcttttgtcagcgatctggaacgcctggcggcgttgctcgacagtggtattaacgatgcg
gtgtatgcggaagtggtgggccacggtgaagtgtggtcggcgcgcctgatgtctgcggta
cttaatcaacaagggctgccagcggcctggcttgatgcccgcgagtttttacgcgctgaa
cgcgccgcacaaccgcaggttgatgaagggctttcttacccgttgctgcaacagctgctg
gtgcaacatccgggcaaacgtctggtggtgaccggatttatcagccgcaacaacgccggt
gaaacggtgctgctggggcgtaacggttccgactattccgcgacacaaatcggtgcgctg
gcgggtgtttctcgcgtaaccatctggagcgacgtcgccggggtatacagtgccgacccg
cgtaaagtgaaagatgcctgcctgctgccgttgctgcgtctggatgaggccagcgaactg
gcgcgcctggcggctcccgttcttcacgcccgtactttacagccggtttctggcagcgaa
atcgacctgcaactgcgctgtagctacacgccggatcaaggttccacgcgcattgaacgc
gtgctggcctccggtactggtgcgcgtattgtcaccagccacgatgatgtctgtttgatt
gagtttcaggtgcccgccagtcaggatttcaaactggcgcataaagagatcgaccaaatc
ctgaaacgcgcgcaggtacgcccgctggcggttggcgtacataacgatcgccagttgctg
caattttgctacacctcagaagtggccgacagtgcgctgaaaatcctcgacgaagcggga
ttacctggcgaactgcgcctgcgtcaggggctggcgctggtggcgatggtcggtgcaggc
gtcacccgtaacccgctgcattgccaccgcttctggcagcaactgaaaggccagccggtc
gaatttacctggcagtccgatgacggcatcagcctggtggcagtactgcgcaccggcccg
accgaaagcctgattcaggggctgcatcagtccgtcttccgcgcagaaaaacgcatcggc
ctggtattgttcggtaagggcaatatcggttcccgttggctggaactgttcgcccgtgag
cagagcacgctttcggcacgtaccggctttgagtttgtgctggcaggtgtggtggacagc
cgccgcagcctgttgagctatgacgggctggacgccagccgcgcgttagccttcttcaac
gatgaagcggttgagcaggatgaagagtcgttgttcctgtggatgcgcgcccatccgtat
gatgatttagtggtgctggacgttaccgccagccagcagcttgctgatcagtatcttgat
ttcgccagccacggtttccacgttatcagcgccaacaaactggcgggagccagcgacagc
aataaatatcgccagatccacgacgccttcgaaaaaaccgggcgtcactggctgtacaat
gccaccgtcggtgcgggcttgccgatcaaccacaccgtgcgcgatctgatcgacagcggc
gatactattttgtcgatcagcgggatcttctccggcacgctctcctggctgttcctgcaa
ttcgacggtagcgtgccgtttaccgagctggtggatcaggcgtggcagcagggcttaacc
gaacctgacccgcgtgacgatctctctggcaaagacgtgatgcgcaagctggtgattctg
gcgcgtgaagcaggttacaacatcgaaccggatcaggtacgtgtggaatcgctggtgcct
gctcattgcgaaggcggcagcatcgaccatttctttgaaaatggcgatgaactgaacgag
cagatggtgcaacggctggaagcggcccgcgaaatggggctggtgctgcgctacgtggcg
cgtttcgatgccaacggtaaagcgcgtgtaggcgtggaagcggtgcgtgaagatcatccg
ttggcatcactgctgccgtgcgataacgtctttgccatcgaaagccgctggtatcgcgat
aaccctctggtgatccgcgtacctggcgctgggcgcgacgtcaccgccggggcgattcag
tcggatatcaaccggctggcacagttgttgtaa

DBGET integrated database retrieval system