KEGG   Shimwellia blattae: EBL_c01500Help
Entry
EBL_c01500        CDS       T02111                                 

Gene name
bcsZ
Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ebt  Shimwellia blattae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EBL_c01500 (bcsZ)
Enzymes [BR:ebt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     EBL_c01500 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
164870..165973
Genome map
AA seq 367 aa AA seqDB search
MRWRGCALALVMACATSRAATCPWPAWEQFKQDYLSDQGRVIDASDPRQITTSEGQSYAL
FFALVADDQTTFDRVLTWTRNNLARGDLSKHLPAWLWGRHSASQWQVLDANNATDADMWI
AWALLEGGRIWHNDTYTRQGEDLLKQIRQESVVRVPGLGMVLLPGKQGFVQPGSWRLNPS
YLPPQVLARMVRYHAPWSEMRAANMALLVDTAPHGYVPDWVVWNKGEGWQLGVKPPLISS
YDAIRAYLWAGMLSDSDPDKARLLDHFAPMITATAARGAPPEKARVADGGLSGEGPVGFS
AALLPALQHSPALQAQRQRVAVNFPGKNAYYNYVLTLFGQGWDQQRYRFSVNGELVLPQD
GSCISSH
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcgatggcgaggatgtgcgctggccctggtgatggcctgcgccacatcccgggccgcg
acctgtccctggccggcctgggagcagtttaaacaggattatctcagcgaccaggggcgg
gtgattgacgccagcgacccgcgccagataaccacctcagaaggacagagctatgcgctg
tttttcgccctggtggcggatgaccagaccacctttgacagggtgctgacctggacccgc
aacaaccttgcccggggggatctgagtaagcacttacccgcctggctgtgggggcgccac
agtgccagccagtggcaggtgctggatgccaacaacgccactgatgcggacatgtggatt
gcctgggcgctgctggaaggggggcggatttggcataacgacacctacacccgccaggga
gaagacttactgaagcaaattcgccaggaatctgtcgtccgggtgccgggtcttggtatg
gtcctgttgcccggtaagcaggggtttgtacagccggggagctggcggcttaaccccagc
tatctgccgccccaggtgctggcgcgcatggtgcgctaccacgccccctggtctgaaatg
cgcgcggccaatatggccttactggtagataccgcgccgcacggttatgtgccggactgg
gtcgtctggaacaagggagagggctggcagcttggtgtgaagccgccgcttatcagcagt
tatgatgccatccgggcttatctgtgggccggtatgctcagtgacagcgatccggacaaa
gcgcggctgctggaccatttcgccccgatgatcaccgcaacagcggcgcgcggggctccg
ccggaaaaagcccgcgtcgcggacggcgggctgagcggtgagggcccggtcggattttct
gccgcgctgctccccgccctgcaacacagcccggcgctacaggcacagcgccagcgggtg
gcggtgaactttcccggcaaaaatgcctattacaattatgttctcacgttatttggccag
ggatgggatcaacagcgttaccggttctccgttaacggggagctggtattaccccaggat
ggatcatgcataagttctcattaa

DBGET integrated database retrieval system