KEGG   Shimwellia blattae: EBL_c01500Help
Entry
EBL_c01500        CDS       T02111                                 

Gene name
bcsZ
Definition
(GenBank) endo-1,4-beta-glucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
ebt  Shimwellia blattae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
164870..165973
Genome map
AA seq 367 aa AA seqDB search
MRWRGCALALVMACATSRAATCPWPAWEQFKQDYLSDQGRVIDASDPRQITTSEGQSYAL
FFALVADDQTTFDRVLTWTRNNLARGDLSKHLPAWLWGRHSASQWQVLDANNATDADMWI
AWALLEGGRIWHNDTYTRQGEDLLKQIRQESVVRVPGLGMVLLPGKQGFVQPGSWRLNPS
YLPPQVLARMVRYHAPWSEMRAANMALLVDTAPHGYVPDWVVWNKGEGWQLGVKPPLISS
YDAIRAYLWAGMLSDSDPDKARLLDHFAPMITATAARGAPPEKARVADGGLSGEGPVGFS
AALLPALQHSPALQAQRQRVAVNFPGKNAYYNYVLTLFGQGWDQQRYRFSVNGELVLPQD
GSCISSH
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcgatggcgaggatgtgcgctggccctggtgatggcctgcgccacatcccgggccgcg
acctgtccctggccggcctgggagcagtttaaacaggattatctcagcgaccaggggcgg
gtgattgacgccagcgacccgcgccagataaccacctcagaaggacagagctatgcgctg
tttttcgccctggtggcggatgaccagaccacctttgacagggtgctgacctggacccgc
aacaaccttgcccggggggatctgagtaagcacttacccgcctggctgtgggggcgccac
agtgccagccagtggcaggtgctggatgccaacaacgccactgatgcggacatgtggatt
gcctgggcgctgctggaaggggggcggatttggcataacgacacctacacccgccaggga
gaagacttactgaagcaaattcgccaggaatctgtcgtccgggtgccgggtcttggtatg
gtcctgttgcccggtaagcaggggtttgtacagccggggagctggcggcttaaccccagc
tatctgccgccccaggtgctggcgcgcatggtgcgctaccacgccccctggtctgaaatg
cgcgcggccaatatggccttactggtagataccgcgccgcacggttatgtgccggactgg
gtcgtctggaacaagggagagggctggcagcttggtgtgaagccgccgcttatcagcagt
tatgatgccatccgggcttatctgtgggccggtatgctcagtgacagcgatccggacaaa
gcgcggctgctggaccatttcgccccgatgatcaccgcaacagcggcgcgcggggctccg
ccggaaaaagcccgcgtcgcggacggcgggctgagcggtgagggcccggtcggattttct
gccgcgctgctccccgccctgcaacacagcccggcgctacaggcacagcgccagcgggtg
gcggtgaactttcccggcaaaaatgcctattacaattatgttctcacgttatttggccag
ggatgggatcaacagcgttaccggttctccgttaacggggagctggtattaccccaggat
ggatcatgcataagttctcattaa

DBGET integrated database retrieval system