KEGG   Shimwellia blattae: EBL_c02140Help
Entry
EBL_c02140        CDS       T02111                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ebt  Shimwellia blattae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EBL_c02140 (malQ)
Enzymes [BR:ebt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     EBL_c02140 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
243101..245221
Genome map
AA seq 706 aa AA seqDB search
MESKRLDKAALAAGIAADYINAHGKTQAIPAQTRQRLLEAMNHTPRPATEAGPVPQVKVL
VQAKKLALAVAGHGEYRWMLTTEQGDQYRGQVSAGSMLTLPAGIATGYHTLTLVRDEARW
NCWLIVAPARCYEPQALREGHKLWGACVQLYTLRSARNWGVGDFGDLRQMVTEMAARGGA
FIGLNPIHALYPATPESASPYSPSSRRWMNIIYIDVEAVEDFSLSTRAQQWWESPETRQQ
LQAARNAHWVDYSAVTALKLTALSMAWQQFLTRGGDDALMAEFRGFIAREGESLFYQAAF
DALHAWQMQQDTTRWGWPVWPREYQDADSPAVAAFCVQHREQVEFYMWLQWIAWRQFSAC
WESCQRHGMPVGLYRDLAVGVAQGGAETWRDKELYCLKASVGAPPDILGPLGQNWGLPPM
DPHIMAQRGYEPFVELLRANMTHCGALRIDHVMSLLRLWWIPYGETADKGAYVHYPVDDL
LAILALESQRHQCMVIGEDLGTVPQEIVAKLRDFGIYSYKVLWFEQDGKGHFRAPEDFTA
QAMAVASTHDMPTVRGYWECGDLALGQSLGLYPDADVLAGLYQDRARAKQSLLDSLHQYQ
CVPQKTGRLAARMKMTPALNRGLQRYIADSNSALLGLQPEDWLDMSQPVNVPGTSDQYPN
WRRKLTHSLEAMFDSPQVNRLLKDLDKHRRQKPLRVAKPARRAKAS
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaagcgtcttgataaagccgcccttgctgcggggattgcagcagactatatc
aacgcccacggtaaaacccaggctattccggcgcagacccggcagcgtttgctggaggcc
atgaaccataccccacgcccggcaacggaggccgggcctgtaccccaggtgaaggtcctg
gttcaggcgaaaaaactcgcgctggcggtggcaggccacggggaataccgctggatgctg
accaccgaacagggcgaccagtaccgcgggcaggttagcgcaggcagtatgctgactttg
cccgccgggattgccacgggctaccacacgctgacgctggtgcgtgacgaggcgcgctgg
aactgctggctgattgtggcaccggcgcgctgttatgagccgcaggcactgcgtgagggc
cacaaactgtggggcgcctgtgtgcagctgtataccctgcgctctgcccgtaactggggg
gtaggggattttggcgatctgcgccagatggtgacagaaatggcggcccggggcggggca
tttattggactgaacccgatccatgcgctctacccggccaccccggaaagcgccagcccg
tacagcccctcatcccggcgctggatgaatattatttatattgatgtggaggccgttgag
gatttctctctcagcacccgggcacagcagtggtgggaaagcccggaaacccgccagcag
ttacaggcggcccggaacgcccactgggtggactacagcgcggtcaccgcgctgaagctg
acggccctctccatggcctggcagcagtttttaaccaggggcggtgacgatgccctgatg
gcggaatttcgcgggtttatcgcccgggagggagagagcctgttttaccaggcggccttt
gatgcgctccacgcctggcagatgcagcaggacaccacccgctggggctggccggtatgg
ccccgggaataccaggatgcagacagcccggcagtggcggcgttttgtgtgcagcaccgg
gagcaggtggaattttacatgtggctacagtggattgcctggcggcagttttccgcctgc
tgggagagctgccagcggcacggtatgccggtggggctctaccgggacctggcggtcggc
gtggcgcaggggggggcggaaacctggcgagacaaagagctgtactgcctgaaggcgtct
gtcggggcaccaccggatatcctcggccccctgggccagaactggggattgccgccaatg
gatccgcatattatggcccagcgcggctacgagccatttgttgagctgctgcgcgctaat
atgacccactgcggcgccctgcgcattgaccatgttatgtcgctgctgcgcctgtggtgg
atcccctacggggaaacggcggataaaggcgcctatgtccactacccggtagatgacctg
ctggcgatcctcgcccttgagagccagcgccaccagtgcatggtgatcggcgaagatctg
ggaaccgtgccacaggagatagtcgccaaactgcgcgattttgggatctactcctacaag
gtgctgtggtttgagcaggatggcaaagggcacttccgggcaccggaggatttcaccgcc
caggcgatggcggtggcctcaactcatgatatgccgacggtgcggggctactgggagtgc
ggtgacctggcgctcgggcagtctctcgggctctacccggatgcggacgtgctggcgggg
ttgtaccaggatcgcgcccgggcgaagcagtcgctgctggacagcctgcatcagtatcag
tgtgtgccgcaaaaaaccgggcgtctggccgcgcgcatgaagatgacgccagccctgaac
cgggggctacagcgctatattgccgacagcaacagtgcgctactggggctacagccggaa
gactggctggatatgtcgcaaccggtcaatgtgcccggcaccagcgatcagtacccgaac
tggcggcgcaaactgacccacagcctggaggcgatgtttgacagcccgcaggtgaaccgg
ctgctaaaagatcttgataagcaccggcggcagaagccactgagggtggcaaaacccgcc
cgccgggcgaaagcgtcctga

DBGET integrated database retrieval system