KEGG   Escherichia blattae DSM 4481: EBL_c04020Help
Entry
EBL_c04020        CDS       T02111                                 

Gene name
folP
Definition
7,8-dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ebt  Escherichia blattae DSM 4481
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ebt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
412107..412955
Genome map
AA seq 282 aa AA seqDB search
MILTAQGTTLDLTHPHVMGILNVTPDSFSDGGQHNSLVEAVKHANLMINAGATIIDIGGE
STRPGAAEVSTQEELDRVIPVVEAIARRFEVWVSVDTSKAEVICESARAGAHIINDIRSL
QEPGALEAAARTGLPVCLMHMQGEPKTMQAAPAYDDVFTDVMQFFTTQIARCEAAGITKD
KLLLDPGFGFGKNLSHNYQLLARLAEFHHFGLPLLVGMSRKSMVGQLLNVGPNQRLSGSL
ACAVIAAMQGAQILRVHDVKETVDAMRVVEATLAAKGNTYYE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgattctgaccgcccagggcactacgctggatcttacccacccccatgtgatggggatt
ctgaatgtcacaccggattcattttctgacggcggtcagcataactccctggtggaagcg
gttaaacacgctaatctgatgattaacgcgggcgcgaccatcattgatattggcggcgaa
tctacccgcccgggggcggcggaagtgagcacgcaagaagagctggatcgggtgattccg
gttgttgaggccatcgcccggcgctttgaggtctgggtgtcggtagatacctccaaagcg
gaggttatctgtgagtctgcccgggccggtgcgcatattatcaatgatatccgctcactg
caggagcccggcgcactggaggcggccgcccggacagggctgccggtctgcctgatgcat
atgcagggggagccgaagaccatgcaggccgccccggcctatgacgatgtcttcaccgat
gtgatgcaattttttaccacccagattgcccgctgcgaggcggccggcattacgaaagat
aaattgttgctcgaccctggcttcggtttcggtaagaatctcagccataattatcagctt
ctggcacgactggcagagttccaccactttggcttgccgcttctggtggggatgtcccgt
aaatctatggtggggcagttgctgaatgtcggcccgaatcagcgcctgagcggtagcctg
gcatgcgccgtaattgcggccatgcagggggcgcagatcctgcgggttcacgatgttaaa
gagacggtggacgccatgcgcgtggtagaggcaacgcttgctgcgaagggaaatacatat
tatgagtaa

DBGET integrated database retrieval system