KEGG   Shimwellia blattae: EBL_c05160Help
Entry
EBL_c05160        CDS       T02111                                 

Gene name
bcsC
Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ebt  Shimwellia blattae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EBL_c05160 (bcsC)
Enzymes [BR:ebt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     EBL_c05160 (bcsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
532033..533043
Genome map
AA seq 336 aa AA seqDB search
MLSRALLLLTLLMTALFSPVSWGETVDWPHFKVRFLMPDGRIVDSGNHNISHTEGQGFGM
LFALQANDKPAFDAIWNWTRDNLRNPQNGLFYWKFNPVASDPVADKNNATDGDTLIAWAL
MQAADKWREPGYQQASDAIQAALIKSMVINYAGYTVMLPGEKGFRQQNGIVLNPSYFVLP
AWQDFARHTHLAVWEKLIADSQRLLAKMQFGTPHLPSDWVYLSEEGNLSPAKAWPARSSY
DAIRVPLYLWWADPANSNLIVWHHWWSQSAREKTPAWVDVSNNQHSPYMISGGLLAVRDL
VMEDASLAGDTAIVEGDDYYSASLKLLVAIARNAHH
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcacgggccttattgttactgacactgttgatgacggcgttatttagccccgtc
tcctggggcgagactgttgactggccgcactttaaagtgcgttttctgatgccggatggc
cgaattgtggacagcggtaaccataatattagccataccgaaggccaggggttcgggatg
ttgtttgccctccaggcgaatgataagcctgcgtttgatgccatctggaactggacccgt
gacaatctgcgcaacccacaaaatggcctgttttactggaagtttaacccggtggccagt
gacccggtggcggataaaaacaatgccactgacggtgatacgctgatcgcctgggcgctg
atgcaggcggcggataaatggcgggagccgggttaccagcaggcctctgacgctatccag
gccgcgctgatcaaatccatggtgatcaactatgccggttatacggtgatgctgcccggt
gaaaagggcttccggcaacagaacggtattgtgctcaatccgtcctattttgtcctgccc
gcctggcaggattttgcccggcatacccacctggcggtctgggaaaaactgatcgccgat
agccagcgcctgctggcaaagatgcagtttgggacgccgcatttacccagcgactgggtc
tacctgtctgaggaagggaacctctcgccggcaaaagcctggcctgcccgatccagctat
gatgccattcgcgtgccgctctacctctggtgggccgatcccgctaatagcaacctgatc
gtctggcaccactggtggtcacaatccgcccgggaaaaaaccccggcctgggttgatgtc
agcaataatcagcattcgccctatatgatttcaggcggattgctggcggtgcgtgatctg
gtgatggaggatgccagtctcgccggtgatacggccattgtggaaggcgatgactactat
tctgccagcctgaaactgctggtggcgatcgcccgcaacgcccatcactag

DBGET integrated database retrieval system