KEGG   Shimwellia blattae: EBL_c05160Help
Entry
EBL_c05160        CDS       T02111                                 

Gene name
bcsC
Definition
(GenBank) endo-1,4-D-glucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
ebt  Shimwellia blattae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
532033..533043
Genome map
AA seq 336 aa AA seqDB search
MLSRALLLLTLLMTALFSPVSWGETVDWPHFKVRFLMPDGRIVDSGNHNISHTEGQGFGM
LFALQANDKPAFDAIWNWTRDNLRNPQNGLFYWKFNPVASDPVADKNNATDGDTLIAWAL
MQAADKWREPGYQQASDAIQAALIKSMVINYAGYTVMLPGEKGFRQQNGIVLNPSYFVLP
AWQDFARHTHLAVWEKLIADSQRLLAKMQFGTPHLPSDWVYLSEEGNLSPAKAWPARSSY
DAIRVPLYLWWADPANSNLIVWHHWWSQSAREKTPAWVDVSNNQHSPYMISGGLLAVRDL
VMEDASLAGDTAIVEGDDYYSASLKLLVAIARNAHH
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcacgggccttattgttactgacactgttgatgacggcgttatttagccccgtc
tcctggggcgagactgttgactggccgcactttaaagtgcgttttctgatgccggatggc
cgaattgtggacagcggtaaccataatattagccataccgaaggccaggggttcgggatg
ttgtttgccctccaggcgaatgataagcctgcgtttgatgccatctggaactggacccgt
gacaatctgcgcaacccacaaaatggcctgttttactggaagtttaacccggtggccagt
gacccggtggcggataaaaacaatgccactgacggtgatacgctgatcgcctgggcgctg
atgcaggcggcggataaatggcgggagccgggttaccagcaggcctctgacgctatccag
gccgcgctgatcaaatccatggtgatcaactatgccggttatacggtgatgctgcccggt
gaaaagggcttccggcaacagaacggtattgtgctcaatccgtcctattttgtcctgccc
gcctggcaggattttgcccggcatacccacctggcggtctgggaaaaactgatcgccgat
agccagcgcctgctggcaaagatgcagtttgggacgccgcatttacccagcgactgggtc
tacctgtctgaggaagggaacctctcgccggcaaaagcctggcctgcccgatccagctat
gatgccattcgcgtgccgctctacctctggtgggccgatcccgctaatagcaacctgatc
gtctggcaccactggtggtcacaatccgcccgggaaaaaaccccggcctgggttgatgtc
agcaataatcagcattcgccctatatgatttcaggcggattgctggcggtgcgtgatctg
gtgatggaggatgccagtctcgccggtgatacggccattgtggaaggcgatgactactat
tctgccagcctgaaactgctggtggcgatcgcccgcaacgcccatcactag

DBGET integrated database retrieval system