KEGG   Escherichia blattae DSM 4481: EBL_c05800Help
Entry
EBL_c05800        CDS       T02111                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ebt  Escherichia blattae DSM 4481
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ebt00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
598372..599289
Genome map
AA seq 305 aa AA seqDB search
MNTLGHQYDNSLVSNAFGFLRLPLSFMPYDSDADWVITGVPFDMATSGRAGGRHGPAAIR
QVSTHLAWEGNRFPWDFDMRQRLKVVDCGDLVYAFGDARDMSEKLQAHAERLLAAGKRML
SFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYAHGAEFDHGTMFHTAPNEGLIDPRH
SVQIGIRTEFDKDNGFTVLDAPQVNDRGVDDIVAQVKQIVGDMPVYLTFDIDCLDPAFAP
GTGTPVMGGLSSDRAIKLVRGLRDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQ
AAKKG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaataccttaggccatcagtatgacaactctctggtatccaatgcctttggtttttta
cgtcttccgctgagtttcatgccatatgatagcgatgcagactgggtgataaccggcgtg
ccttttgatatggctacgtctggccgcgcaggtggccgccatggcccggccgctatccgc
caggtctctacccacctggcatgggaaggaaaccgcttcccgtgggatttcgacatgcgc
cagcgcctgaaggtggtggactgcggtgacctggtgtatgccttcggggatgcccgggac
atgagcgaaaaactccaggcccacgccgaacgcctgctggccgccggtaagcggatgctc
tccttcggtggggaccactttgttaccctgccgctgctgcgcgcccacgcaaagcatttt
ggtaaaatggcgctggtgcattttgatgcccatacggacacctacgcccacggggcagag
tttgaccacggcaccatgttccacaccgccccgaatgaagggcttatcgatccccgccat
tcggtgcagatcggtatccgtaccgagtttgacaaagacaacggctttaccgtgctggat
gcaccgcaggttaacgatcgcggtgtggacgatattgtggcccaggtgaagcagattgtc
ggcgatatgccggtgtacctgacctttgatatcgactgcctggatccggcatttgcgccg
ggtaccgggacgccggttatgggtgggctgagctctgatcgggccatcaaactggtgcgt
ggcctgcgcgatctcaatattgtcggtatggacgtggtcgaagtggccccggcctatgac
cagtcggaaatcaccgctctggcggcggcaaccctggcgctggagatgctctatatccag
gcggcaaaaaagggctga

DBGET integrated database retrieval system