KEGG   Shimwellia blattae: EBL_c06860Help
Entry
EBL_c06860        CDS       T02111                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ebt  Shimwellia blattae
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EBL_c06860 (bglA)
Enzymes [BR:ebt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EBL_c06860 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
702097..703533
Genome map
AA seq 478 aa AA seqDB search
MMKKLTLPEDFLWGGAVAAHQVEGGWDQGGKGPSICDVLTGGAHGVPREITPRVEPGKYY
PNHEAVDFYHRYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEPQPDEAGLKFYDDMFDEL
LKYNIEPVITLSHFEMPLHLVQEYGGWTSRKVVDCFVRFAEVVFERYCHKVKYWMTFNEI
NNQRNWRAPLFGYCCSGVVFTEHENPEETMYQVLHHQFVASALAVKAARRINPEMKVGCM
LAMVALYPFSCDPQDVMFAQKSMRERYLFTDVQLRGYYPSYVLNEWQRRGFHIHMAPGDE
QILREGTCDFLGFSYYMTCAVKASGGSGDAISGFEGSVPNPYVKASDWGWQIDPVGLRYA
LCELYERYQKPLFIVENGFGACDKVESDGTINDDYRIDYLRAHIAEMIKAVTHDGVALMG
YTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMARSRKKSFYWYQGVIASNGEAL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaactgacgctgccagaagacttcttatgggggggcgcggtggctgcccac
caggtggaaggtggctgggatcagggggggaaaggcccgagtatctgcgacgtgctgacc
ggcggtgcccacggtgttccccgggagataaccccccgggtagagccgggcaaatactac
ccgaaccatgaagcggtggatttttatcaccgctacaaagaagacatcaaactgtttgcc
gaaatggggtttaagtgttttcgcacctccattgcctggacacgcatcttcccgaagggg
gatgagccgcagccggacgaagcagggctgaagttttatgatgatatgtttgatgagctg
ctgaagtacaacattgaaccggtcatcaccctgtcgcactttgaaatgccgctgcatctg
gtacaggagtatggcggctggaccagccgcaaagtggtggactgctttgtccgcttcgcg
gaggtggtgtttgagcgctactgccataaagtgaaatactggatgacctttaacgagatc
aataaccagcgcaactggcgggcaccgcttttcggttactgctgttccggggtggtgttt
acggagcacgaaaacccggaagaaaccatgtaccaggtgctgcaccaccagtttgtggcc
agcgccctggcggtgaaagcggcacggcgcattaacccggaaatgaaagtgggctgcatg
ctggcgatggtggcgctgtatccgttctcctgcgatccgcaagacgtgatgtttgcccaa
aaatccatgcgtgagcgctacctgtttacggatgttcagctgcgtggttactacccctcc
tacgtgcttaacgagtggcagcgccgcggttttcatattcatatggcccccggtgatgag
cagatcctgcgcgagggtacctgtgatttcctggggttcagctattacatgacctgcgcg
gtgaaagccagcggaggaagcggcgacgctatctctggctttgagggcagtgtgcccaac
ccttatgtgaaggcttcagactgggggtggcagatcgatccggtgggcctgcgttacgcc
ctgtgcgagctctatgagcgctaccagaagccgctgtttattgtggagaacggtttcggc
gcctgtgacaaggtggagtcagacggcaccatcaatgatgattaccgcattgactacctg
cgtgcccatattgccgagatgatcaaggctgtcacccacgacggggtcgcgctgatgggc
tacaccccctggggctgcattgactgcgtgtcctttaccaccggccagtacagcaagcgc
tacggctttatctatgtgaataaacacgatgacggcaccggggatatggcccgctcgcgc
aagaaaagtttttactggtatcagggggttatcgccagtaacggggaggccctgtaa

DBGET integrated database retrieval system