KEGG   Escherichia blattae DSM 4481: EBL_c06920Help
Entry
EBL_c06920        CDS       T02111                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ebt  Escherichia blattae DSM 4481
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
707028..707744
Genome map
AA seq 238 aa AA seqDB search
MKKGVLLLALLATTVSGFAHADDAAIKQALSHLGVSSPDIQPAPLAGMKTVLTDSGVLYV
TDDGKHVIQGPLYDVSGKQPVNVTNQLLLGKLNGLEKEMITYKSPNEKHVITVFTDITCG
YCHKLHEEMSDYNALGITVRYLAFPRQGLNSQAEQDMKAIWCAKDKNKAFDAAMKGGKVA
PASCAVNLANHYKLGIQFGVQGTPAIVLKDGTVVPGYQSPKEMKEFLDKHQKMTASGQ
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtgtattactgctggcactgctggcaaccacagtttccggctttgcccat
gcagatgacgccgccatcaaacaggcgttaagccaccttggcgtctccagcccggatatt
cagcccgcgccgctggctggcatgaaaacggtactgaccgacagcggcgtactgtacgtg
accgacgacggcaaacatgtgattcagggcccgctgtatgacgtgagcggcaaacagccg
gttaatgtcaccaaccagctgctgcttggtaagctcaacgggctggaaaaagagatgatt
acctataaatcccccaacgagaaacacgttatcaccgtgtttaccgacatcacctgcggc
tactgccacaagctgcacgaagagatgagcgactacaacgcgctggggatcaccgtgcgc
taccttgccttcccgcgccaggggctgaacagccaggccgagcaggatatgaaagctatc
tggtgtgctaaagacaaaaacaaagccttcgacgcggccatgaaaggcggcaaagtggcc
ccggccagctgtgccgttaacctggcaaaccactataagctggggatccagttcggggtt
cagggcacccctgccattgtgctgaaagacggcaccgtggtgcccgggtatcagagcccg
aaagagatgaaagaattccttgataaacaccagaaaatgacagcgagtggtcagtaa

DBGET integrated database retrieval system